BLASTX nr result
ID: Mentha26_contig00026727
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00026727 (346 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38834.1| hypothetical protein MIMGU_mgv1a000626mg [Mimulus... 64 3e-08 >gb|EYU38834.1| hypothetical protein MIMGU_mgv1a000626mg [Mimulus guttatus] Length = 1041 Score = 63.5 bits (153), Expect = 3e-08 Identities = 39/82 (47%), Positives = 52/82 (63%), Gaps = 2/82 (2%) Frame = +3 Query: 3 ELVSRVASVEVHTSTDSPSKNQLPSEYQVPSREDSADP--FSKLRSELSRVIESMSKEKD 176 ELV SVEV TDS S +Q + + + + ADP F KL+SE+SRV+ES+S EKD Sbjct: 517 ELVKDEVSVEVTVHTDSQSDDQCVT---LANHQLQADPLVFVKLQSEISRVLESLSNEKD 573 Query: 177 MEKVIVDARHIMQEMIDASRQH 242 MEKV D R +M++M + QH Sbjct: 574 MEKVTDDIRCVMEDMRETLHQH 595