BLASTX nr result
ID: Mentha26_contig00026708
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00026708 (1291 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34665.1| hypothetical protein MIMGU_mgv1a009170mg [Mimulus... 58 8e-06 gb|EYU34106.1| hypothetical protein MIMGU_mgv1a009166mg [Mimulus... 58 8e-06 gb|EPS71418.1| hypothetical protein M569_03330 [Genlisea aurea] 58 8e-06 >gb|EYU34665.1| hypothetical protein MIMGU_mgv1a009170mg [Mimulus guttatus] Length = 351 Score = 58.2 bits (139), Expect = 8e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +2 Query: 2 KLVDEYKHMLTQATEPLSTFLEYITYVYLTFAVCLL 109 KLVDEYKHMLTQATEPLSTFLEYITY ++ V L+ Sbjct: 77 KLVDEYKHMLTQATEPLSTFLEYITYGHMIDNVVLI 112 >gb|EYU34106.1| hypothetical protein MIMGU_mgv1a009166mg [Mimulus guttatus] Length = 351 Score = 58.2 bits (139), Expect = 8e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +2 Query: 2 KLVDEYKHMLTQATEPLSTFLEYITYVYLTFAVCLL 109 KLVDEYKHMLTQATEPLSTFLEYITY ++ V L+ Sbjct: 77 KLVDEYKHMLTQATEPLSTFLEYITYGHMIDNVVLI 112 >gb|EPS71418.1| hypothetical protein M569_03330 [Genlisea aurea] Length = 351 Score = 58.2 bits (139), Expect = 8e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +2 Query: 2 KLVDEYKHMLTQATEPLSTFLEYITYVYLTFAVCLL 109 KLVDEYKHMLTQATEPLSTFLEYITY ++ V L+ Sbjct: 77 KLVDEYKHMLTQATEPLSTFLEYITYGHMIDNVVLI 112