BLASTX nr result
ID: Mentha26_contig00026375
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00026375 (376 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21605.1| hypothetical protein MIMGU_mgv1a015248mg [Mimulus... 75 9e-12 ref|XP_006356193.1| PREDICTED: cytochrome c oxidase subunit 5b-1... 57 2e-06 gb|ABB87114.1| cytochrome c oxidase family protein-like [Solanum... 57 3e-06 ref|XP_004241710.1| PREDICTED: cytochrome c oxidase subunit 5b-2... 55 8e-06 >gb|EYU21605.1| hypothetical protein MIMGU_mgv1a015248mg [Mimulus guttatus] gi|604302020|gb|EYU21606.1| hypothetical protein MIMGU_mgv1a015248mg [Mimulus guttatus] Length = 163 Score = 75.1 bits (183), Expect = 9e-12 Identities = 42/65 (64%), Positives = 50/65 (76%), Gaps = 3/65 (4%) Frame = -3 Query: 188 MFRRLAIQLRTLVPPRS---ASKTAVGASRQSENVIRSLPVYSRHFSTESGNVPKKVENV 18 MFRRLAIQLRTL P RS A++ AVG+ ENVIR P++SRHF+ ESG V K+VE+V Sbjct: 1 MFRRLAIQLRTLAPARSTRAAARFAVGSPIAPENVIRPFPIFSRHFAAESG-VTKRVEDV 59 Query: 17 MPIAT 3 MPIAT Sbjct: 60 MPIAT 64 >ref|XP_006356193.1| PREDICTED: cytochrome c oxidase subunit 5b-1, mitochondrial-like [Solanum tuberosum] Length = 166 Score = 57.4 bits (137), Expect = 2e-06 Identities = 34/68 (50%), Positives = 42/68 (61%), Gaps = 6/68 (8%) Frame = -3 Query: 188 MFRRLAIQLRTLVPPRSASKT------AVGASRQSENVIRSLPVYSRHFSTESGNVPKKV 27 M+RRL+ Q+RTL P RS +K+ A S ++P SRHFST S NV KKV Sbjct: 1 MWRRLSSQVRTLSPLRSTAKSNRLSAAATSLSSSPATFRPTVPFISRHFSTASANVVKKV 60 Query: 26 ENVMPIAT 3 E+VMPIAT Sbjct: 61 EDVMPIAT 68 >gb|ABB87114.1| cytochrome c oxidase family protein-like [Solanum tuberosum] Length = 167 Score = 57.0 bits (136), Expect = 3e-06 Identities = 35/69 (50%), Positives = 45/69 (65%), Gaps = 7/69 (10%) Frame = -3 Query: 188 MFRRLAIQLRTLVPPRSASKT------AVGASRQSENVIR-SLPVYSRHFSTESGNVPKK 30 M+RRL+ Q+RTL P RS +K+ AV + S R ++P SRHFST S NV KK Sbjct: 1 MWRRLSSQVRTLSPLRSTAKSNRLSAAAVTSLSSSPATFRPTVPFISRHFSTASANVVKK 60 Query: 29 VENVMPIAT 3 +E+VMPIAT Sbjct: 61 IEDVMPIAT 69 >ref|XP_004241710.1| PREDICTED: cytochrome c oxidase subunit 5b-2, mitochondrial-like [Solanum lycopersicum] Length = 165 Score = 55.5 bits (132), Expect = 8e-06 Identities = 34/67 (50%), Positives = 43/67 (64%), Gaps = 5/67 (7%) Frame = -3 Query: 188 MFRRLAIQLRTLVPPRSASKT----AVGASRQSENVIR-SLPVYSRHFSTESGNVPKKVE 24 M+RRL+ Q+RTL P RS +K+ A S R ++P +RHFST S NV KKVE Sbjct: 1 MWRRLSSQVRTLSPLRSTAKSNRLSAAATLPSSPATFRPTVPFIARHFSTASANVVKKVE 60 Query: 23 NVMPIAT 3 +VMPIAT Sbjct: 61 DVMPIAT 67