BLASTX nr result
ID: Mentha26_contig00026374
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00026374 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21605.1| hypothetical protein MIMGU_mgv1a015248mg [Mimulus... 72 6e-11 ref|XP_006356193.1| PREDICTED: cytochrome c oxidase subunit 5b-1... 62 8e-08 gb|ABB87114.1| cytochrome c oxidase family protein-like [Solanum... 62 1e-07 ref|XP_004241710.1| PREDICTED: cytochrome c oxidase subunit 5b-2... 60 3e-07 >gb|EYU21605.1| hypothetical protein MIMGU_mgv1a015248mg [Mimulus guttatus] gi|604302020|gb|EYU21606.1| hypothetical protein MIMGU_mgv1a015248mg [Mimulus guttatus] Length = 163 Score = 72.4 bits (176), Expect = 6e-11 Identities = 44/66 (66%), Positives = 51/66 (77%), Gaps = 3/66 (4%) Frame = -3 Query: 191 MFRRLAIQLRTLAPPRS---ASKAAVGASRHSSETVIRSLPVYSRHFSNESGNVPKKVED 21 MFRRLAIQLRTLAP RS A++ AVG S + E VIR P++SRHF+ ESG V K+VED Sbjct: 1 MFRRLAIQLRTLAPARSTRAAARFAVG-SPIAPENVIRPFPIFSRHFAAESG-VTKRVED 58 Query: 20 VMPIAT 3 VMPIAT Sbjct: 59 VMPIAT 64 >ref|XP_006356193.1| PREDICTED: cytochrome c oxidase subunit 5b-1, mitochondrial-like [Solanum tuberosum] Length = 166 Score = 62.0 bits (149), Expect = 8e-08 Identities = 37/68 (54%), Positives = 45/68 (66%), Gaps = 5/68 (7%) Frame = -3 Query: 191 MFRRLAIQLRTLAPPRSASKA----AVGASRHSSETVIR-SLPVYSRHFSNESGNVPKKV 27 M+RRL+ Q+RTL+P RS +K+ A S SS R ++P SRHFS S NV KKV Sbjct: 1 MWRRLSSQVRTLSPLRSTAKSNRLSAAATSLSSSPATFRPTVPFISRHFSTASANVVKKV 60 Query: 26 EDVMPIAT 3 EDVMPIAT Sbjct: 61 EDVMPIAT 68 >gb|ABB87114.1| cytochrome c oxidase family protein-like [Solanum tuberosum] Length = 167 Score = 61.6 bits (148), Expect = 1e-07 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 6/69 (8%) Frame = -3 Query: 191 MFRRLAIQLRTLAPPRSASK------AAVGASRHSSETVIRSLPVYSRHFSNESGNVPKK 30 M+RRL+ Q+RTL+P RS +K AAV + S T ++P SRHFS S NV KK Sbjct: 1 MWRRLSSQVRTLSPLRSTAKSNRLSAAAVTSLSSSPATFRPTVPFISRHFSTASANVVKK 60 Query: 29 VEDVMPIAT 3 +EDVMPIAT Sbjct: 61 IEDVMPIAT 69 >ref|XP_004241710.1| PREDICTED: cytochrome c oxidase subunit 5b-2, mitochondrial-like [Solanum lycopersicum] Length = 165 Score = 60.1 bits (144), Expect = 3e-07 Identities = 35/67 (52%), Positives = 46/67 (68%), Gaps = 4/67 (5%) Frame = -3 Query: 191 MFRRLAIQLRTLAPPRSASKA---AVGASRHSSETVIR-SLPVYSRHFSNESGNVPKKVE 24 M+RRL+ Q+RTL+P RS +K+ + A+ SS R ++P +RHFS S NV KKVE Sbjct: 1 MWRRLSSQVRTLSPLRSTAKSNRLSAAATLPSSPATFRPTVPFIARHFSTASANVVKKVE 60 Query: 23 DVMPIAT 3 DVMPIAT Sbjct: 61 DVMPIAT 67