BLASTX nr result
ID: Mentha26_contig00026335
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00026335 (332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23553.1| hypothetical protein MIMGU_mgv1a010717mg [Mimulus... 83 3e-14 >gb|EYU23553.1| hypothetical protein MIMGU_mgv1a010717mg [Mimulus guttatus] Length = 304 Score = 83.2 bits (204), Expect = 3e-14 Identities = 40/55 (72%), Positives = 47/55 (85%), Gaps = 1/55 (1%) Frame = -2 Query: 163 MSNPNITLSIASPQ-NITDPPVRAKIVRISEWYNSQTEGCNSFWRETALVVPSVL 2 MSNPNITLSIAS NIT+PPVR++I R+SEWY+ + GCNSFWRE ALVVPS+L Sbjct: 1 MSNPNITLSIASVAINITEPPVRSRIGRVSEWYSYGSAGCNSFWREAALVVPSIL 55