BLASTX nr result
ID: Mentha26_contig00026251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00026251 (582 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35651.1| hypothetical protein MIMGU_mgv1a005476mg [Mimulus... 68 2e-09 gb|EPS67604.1| hypothetical protein M569_07168, partial [Genlise... 57 3e-06 >gb|EYU35651.1| hypothetical protein MIMGU_mgv1a005476mg [Mimulus guttatus] Length = 482 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -3 Query: 580 SFMMWRTNWDEEVLKASARLKKWYLKSPEEISSKPELA 467 SFMMWRTNWDEEVLKAS RL+KWYLKSPEE + K + A Sbjct: 445 SFMMWRTNWDEEVLKASTRLRKWYLKSPEEANRKSDEA 482 >gb|EPS67604.1| hypothetical protein M569_07168, partial [Genlisea aurea] Length = 207 Score = 57.4 bits (137), Expect = 3e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -3 Query: 574 MMWRTNWDEEVLKASARLKKWYLKSPEE 491 MMWRTNWD+EVLK + RL+KWYLKSPEE Sbjct: 179 MMWRTNWDDEVLKTTNRLRKWYLKSPEE 206