BLASTX nr result
ID: Mentha26_contig00026154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00026154 (492 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17498.1| hypothetical protein MIMGU_mgv1a002335mg [Mimulus... 66 2e-16 ref|XP_004244963.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-14 ref|XP_006435342.1| hypothetical protein CICLE_v10000451mg [Citr... 62 6e-14 ref|XP_006346695.1| PREDICTED: pentatricopeptide repeat-containi... 59 6e-14 ref|XP_004500882.1| PREDICTED: pentatricopeptide repeat-containi... 61 9e-14 ref|XP_004500883.1| PREDICTED: pentatricopeptide repeat-containi... 61 9e-14 ref|XP_006473770.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-13 ref|XP_006473771.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-13 ref|XP_004144287.1| PREDICTED: pentatricopeptide repeat-containi... 63 3e-13 ref|XP_007018010.1| Pentatricopeptide repeat (PPR-like) superfam... 61 3e-13 ref|XP_007018011.1| Pentatricopeptide repeat (PPR-like) superfam... 61 3e-13 ref|XP_002306972.1| hypothetical protein POPTR_0005s27160g [Popu... 60 5e-13 ref|XP_003527377.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-13 ref|XP_003523110.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-13 emb|CAN83144.1| hypothetical protein VITISV_040783 [Vitis vinifera] 60 8e-13 ref|XP_002865541.1| pentatricopeptide repeat-containing protein ... 61 8e-13 ref|NP_199046.1| pentatricopeptide repeat-containing protein [Ar... 61 8e-13 ref|XP_006279580.1| hypothetical protein CARUB_v10025981mg [Caps... 61 8e-13 ref|XP_006405260.1| hypothetical protein EUTSA_v10027665mg [Eutr... 61 8e-13 ref|XP_002272226.1| PREDICTED: pentatricopeptide repeat-containi... 60 8e-13 >gb|EYU17498.1| hypothetical protein MIMGU_mgv1a002335mg [Mimulus guttatus] Length = 687 Score = 66.2 bits (160), Expect(2) = 2e-16 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 490 PDVVTYTTLMKALIRVDKYEKVPAVFEEMLLSG 392 PDVVTYTTLMKALIRV+KYEKVPAVFEEMLLSG Sbjct: 631 PDVVTYTTLMKALIRVEKYEKVPAVFEEMLLSG 663 Score = 45.1 bits (105), Expect(2) = 2e-16 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -2 Query: 389 APDRKARAMLRSALRYMKSALKL 321 APDRKARAMLRSALRYMKS LKL Sbjct: 665 APDRKARAMLRSALRYMKSTLKL 687 >ref|XP_004244963.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Solanum lycopersicum] Length = 699 Score = 61.2 bits (147), Expect(2) = 2e-14 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 490 PDVVTYTTLMKALIRVDKYEKVPAVFEEMLLSGLL 386 PDVVTYTTLMK LIRV+K+E+VPAV+EEMLLSG + Sbjct: 643 PDVVTYTTLMKTLIRVEKFERVPAVYEEMLLSGCI 677 Score = 43.5 bits (101), Expect(2) = 2e-14 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 386 PDRKARAMLRSALRYMKSALKL 321 PDRKARAMLRSALRYMKS LKL Sbjct: 678 PDRKARAMLRSALRYMKSTLKL 699 >ref|XP_006435342.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] gi|567885569|ref|XP_006435343.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] gi|557537464|gb|ESR48582.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] gi|557537465|gb|ESR48583.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] Length = 704 Score = 62.4 bits (150), Expect(2) = 6e-14 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 490 PDVVTYTTLMKALIRVDKYEKVPAVFEEMLLSG 392 PDVVTYTTLMKALIRVDK+ KVPAV+EEM+LSG Sbjct: 648 PDVVTYTTLMKALIRVDKFHKVPAVYEEMILSG 680 Score = 40.4 bits (93), Expect(2) = 6e-14 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -2 Query: 386 PDRKARAMLRSALRYMKSALK 324 PDRKARAMLRSALRYMK LK Sbjct: 683 PDRKARAMLRSALRYMKQTLK 703 >ref|XP_006346695.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Solanum tuberosum] Length = 697 Score = 59.3 bits (142), Expect(2) = 6e-14 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -3 Query: 490 PDVVTYTTLMKALIRVDKYEKVPAVFEEMLLSGLL 386 PDVVTYTTLMK LIRV+K+E+VPAV+EEMLL G + Sbjct: 641 PDVVTYTTLMKTLIRVEKFERVPAVYEEMLLCGCI 675 Score = 43.5 bits (101), Expect(2) = 6e-14 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 386 PDRKARAMLRSALRYMKSALKL 321 PDRKARAMLRSALRYMKS LKL Sbjct: 676 PDRKARAMLRSALRYMKSTLKL 697 >ref|XP_004500882.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Cicer arietinum] Length = 720 Score = 61.2 bits (147), Expect(2) = 9e-14 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 490 PDVVTYTTLMKALIRVDKYEKVPAVFEEMLLSG 392 PDVVTYTTLMK+LIRVDKY KVPAV+EEM++SG Sbjct: 664 PDVVTYTTLMKSLIRVDKYPKVPAVYEEMVMSG 696 Score = 40.8 bits (94), Expect(2) = 9e-14 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -2 Query: 389 APDRKARAMLRSALRYMKSALK 324 APDRKARAMLRSALRYMK L+ Sbjct: 698 APDRKARAMLRSALRYMKQTLR 719 >ref|XP_004500883.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Cicer arietinum] Length = 691 Score = 61.2 bits (147), Expect(2) = 9e-14 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 490 PDVVTYTTLMKALIRVDKYEKVPAVFEEMLLSG 392 PDVVTYTTLMK+LIRVDKY KVPAV+EEM++SG Sbjct: 635 PDVVTYTTLMKSLIRVDKYPKVPAVYEEMVMSG 667 Score = 40.8 bits (94), Expect(2) = 9e-14 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -2 Query: 389 APDRKARAMLRSALRYMKSALK 324 APDRKARAMLRSALRYMK L+ Sbjct: 669 APDRKARAMLRSALRYMKQTLR 690 >ref|XP_006473770.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Citrus sinensis] Length = 704 Score = 60.1 bits (144), Expect(2) = 3e-13 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 490 PDVVTYTTLMKALIRVDKYEKVPAVFEEMLLSG 392 PDVVTYTTLMKALIRVDK+ KVPAV+EEM+ SG Sbjct: 648 PDVVTYTTLMKALIRVDKFHKVPAVYEEMISSG 680 Score = 40.4 bits (93), Expect(2) = 3e-13 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -2 Query: 386 PDRKARAMLRSALRYMKSALK 324 PDRKARAMLRSALRYMK LK Sbjct: 683 PDRKARAMLRSALRYMKQTLK 703 >ref|XP_006473771.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Citrus sinensis] gi|568839606|ref|XP_006473772.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Citrus sinensis] Length = 99 Score = 60.1 bits (144), Expect(2) = 3e-13 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 490 PDVVTYTTLMKALIRVDKYEKVPAVFEEMLLSG 392 PDVVTYTTLMKALIRVDK+ KVPAV+EEM+ SG Sbjct: 43 PDVVTYTTLMKALIRVDKFHKVPAVYEEMISSG 75 Score = 40.4 bits (93), Expect(2) = 3e-13 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -2 Query: 386 PDRKARAMLRSALRYMKSALK 324 PDRKARAMLRSALRYMK LK Sbjct: 78 PDRKARAMLRSALRYMKQTLK 98 >ref|XP_004144287.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Cucumis sativus] gi|449489420|ref|XP_004158306.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Cucumis sativus] Length = 720 Score = 63.2 bits (152), Expect(2) = 3e-13 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 490 PDVVTYTTLMKALIRVDKYEKVPAVFEEMLLSG 392 PDVVTYTTLMKALIRVDK++KVPAV+EEM+LSG Sbjct: 664 PDVVTYTTLMKALIRVDKFDKVPAVYEEMILSG 696 Score = 37.0 bits (84), Expect(2) = 3e-13 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -2 Query: 386 PDRKARAMLRSALRYMKSALKL 321 PD KARAMLRSALRYMK L L Sbjct: 699 PDGKARAMLRSALRYMKRTLSL 720 >ref|XP_007018010.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508723338|gb|EOY15235.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] Length = 703 Score = 61.2 bits (147), Expect(2) = 3e-13 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 490 PDVVTYTTLMKALIRVDKYEKVPAVFEEMLLSG 392 PDVVTYTTLMK+LIRVDK+ KVPAV+EEM+LSG Sbjct: 647 PDVVTYTTLMKSLIRVDKFHKVPAVYEEMILSG 679 Score = 38.9 bits (89), Expect(2) = 3e-13 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 386 PDRKARAMLRSALRYMKSALK 324 PDRKARAMLRSALRYMK +K Sbjct: 682 PDRKARAMLRSALRYMKQKVK 702 >ref|XP_007018011.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 2, partial [Theobroma cacao] gi|508723339|gb|EOY15236.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 2, partial [Theobroma cacao] Length = 698 Score = 61.2 bits (147), Expect(2) = 3e-13 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 490 PDVVTYTTLMKALIRVDKYEKVPAVFEEMLLSG 392 PDVVTYTTLMK+LIRVDK+ KVPAV+EEM+LSG Sbjct: 642 PDVVTYTTLMKSLIRVDKFHKVPAVYEEMILSG 674 Score = 38.9 bits (89), Expect(2) = 3e-13 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 386 PDRKARAMLRSALRYMKSALK 324 PDRKARAMLRSALRYMK +K Sbjct: 677 PDRKARAMLRSALRYMKQKVK 697 >ref|XP_002306972.1| hypothetical protein POPTR_0005s27160g [Populus trichocarpa] gi|222856421|gb|EEE93968.1| hypothetical protein POPTR_0005s27160g [Populus trichocarpa] Length = 709 Score = 60.5 bits (145), Expect(2) = 5e-13 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -3 Query: 490 PDVVTYTTLMKALIRVDKYEKVPAVFEEMLLSG 392 PDVVTYTTLMKALIRV+K++KVP+V+EEM+LSG Sbjct: 653 PDVVTYTTLMKALIRVEKFDKVPSVYEEMILSG 685 Score = 39.3 bits (90), Expect(2) = 5e-13 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -2 Query: 386 PDRKARAMLRSALRYMKSALKL 321 PDRKARAMLRSAL+YMK L+L Sbjct: 688 PDRKARAMLRSALKYMKQTLEL 709 >ref|XP_003527377.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Glycine max] Length = 696 Score = 59.3 bits (142), Expect(2) = 5e-13 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -3 Query: 490 PDVVTYTTLMKALIRVDKYEKVPAVFEEMLLSG 392 PDVVTYTTLMKALIRV+K++KVPAV+EEM+ SG Sbjct: 640 PDVVTYTTLMKALIRVEKFQKVPAVYEEMVTSG 672 Score = 40.4 bits (93), Expect(2) = 5e-13 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -2 Query: 386 PDRKARAMLRSALRYMKSALK 324 PDRKARAMLRSALRYMK LK Sbjct: 675 PDRKARAMLRSALRYMKQTLK 695 >ref|XP_003523110.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Glycine max] Length = 680 Score = 59.3 bits (142), Expect(2) = 5e-13 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -3 Query: 490 PDVVTYTTLMKALIRVDKYEKVPAVFEEMLLSG 392 PDVVTYTTLMKALIRV+K++KVPAV+EEM+ SG Sbjct: 624 PDVVTYTTLMKALIRVEKFQKVPAVYEEMVASG 656 Score = 40.4 bits (93), Expect(2) = 5e-13 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -2 Query: 386 PDRKARAMLRSALRYMKSALK 324 PDRKARAMLRSALRYMK LK Sbjct: 659 PDRKARAMLRSALRYMKQTLK 679 >emb|CAN83144.1| hypothetical protein VITISV_040783 [Vitis vinifera] Length = 724 Score = 60.5 bits (145), Expect(2) = 8e-13 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 490 PDVVTYTTLMKALIRVDKYEKVPAVFEEMLLSG 392 PDVVTYTTLMKALIRV+K++KVPAV+EEM LSG Sbjct: 668 PDVVTYTTLMKALIRVEKFDKVPAVYEEMTLSG 700 Score = 38.5 bits (88), Expect(2) = 8e-13 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 386 PDRKARAMLRSALRYMKSALK 324 PDRKARAMLRSALRYM+ LK Sbjct: 703 PDRKARAMLRSALRYMERTLK 723 >ref|XP_002865541.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297311376|gb|EFH41800.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 711 Score = 60.8 bits (146), Expect(2) = 8e-13 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -3 Query: 490 PDVVTYTTLMKALIRVDKYEKVPAVFEEMLLSG 392 PDVVTYTTLMKALIRVDK++KVP V+EEM++SG Sbjct: 654 PDVVTYTTLMKALIRVDKFQKVPGVYEEMIMSG 686 Score = 38.1 bits (87), Expect(2) = 8e-13 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -2 Query: 386 PDRKARAMLRSALRYMKSALK 324 PDRKAR+MLRSALRYMK L+ Sbjct: 689 PDRKARSMLRSALRYMKQTLR 709 >ref|NP_199046.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75154282|sp|Q8L844.1|PP413_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g42310, mitochondrial; Flags: Precursor gi|21539517|gb|AAM53311.1| maize crp1 protein-like [Arabidopsis thaliana] gi|332007411|gb|AED94794.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 709 Score = 60.8 bits (146), Expect(2) = 8e-13 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -3 Query: 490 PDVVTYTTLMKALIRVDKYEKVPAVFEEMLLSG 392 PDVVTYTTLMKALIRVDK++KVP V+EEM++SG Sbjct: 652 PDVVTYTTLMKALIRVDKFQKVPVVYEEMIMSG 684 Score = 38.1 bits (87), Expect(2) = 8e-13 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -2 Query: 386 PDRKARAMLRSALRYMKSALK 324 PDRKAR+MLRSALRYMK L+ Sbjct: 687 PDRKARSMLRSALRYMKQTLR 707 >ref|XP_006279580.1| hypothetical protein CARUB_v10025981mg [Capsella rubella] gi|482548284|gb|EOA12478.1| hypothetical protein CARUB_v10025981mg [Capsella rubella] Length = 708 Score = 60.8 bits (146), Expect(2) = 8e-13 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -3 Query: 490 PDVVTYTTLMKALIRVDKYEKVPAVFEEMLLSG 392 PDVVTYTTLMKALIRVDK++KVP V+EEM++SG Sbjct: 651 PDVVTYTTLMKALIRVDKFQKVPGVYEEMIMSG 683 Score = 38.1 bits (87), Expect(2) = 8e-13 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -2 Query: 386 PDRKARAMLRSALRYMKSALK 324 PDRKAR+MLRSALRYMK L+ Sbjct: 686 PDRKARSMLRSALRYMKQTLR 706 >ref|XP_006405260.1| hypothetical protein EUTSA_v10027665mg [Eutrema salsugineum] gi|557106398|gb|ESQ46713.1| hypothetical protein EUTSA_v10027665mg [Eutrema salsugineum] Length = 704 Score = 60.8 bits (146), Expect(2) = 8e-13 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -3 Query: 490 PDVVTYTTLMKALIRVDKYEKVPAVFEEMLLSG 392 PDVVTYTTLMKALIRVDK++KVP V+EEM++SG Sbjct: 647 PDVVTYTTLMKALIRVDKFQKVPGVYEEMIMSG 679 Score = 38.1 bits (87), Expect(2) = 8e-13 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -2 Query: 386 PDRKARAMLRSALRYMKSALK 324 PDRKAR+MLRSALRYMK L+ Sbjct: 682 PDRKARSMLRSALRYMKQTLR 702 >ref|XP_002272226.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Vitis vinifera] gi|297745544|emb|CBI40709.3| unnamed protein product [Vitis vinifera] Length = 695 Score = 60.5 bits (145), Expect(2) = 8e-13 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 490 PDVVTYTTLMKALIRVDKYEKVPAVFEEMLLSG 392 PDVVTYTTLMKALIRV+K++KVPAV+EEM LSG Sbjct: 639 PDVVTYTTLMKALIRVEKFDKVPAVYEEMTLSG 671 Score = 38.5 bits (88), Expect(2) = 8e-13 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 386 PDRKARAMLRSALRYMKSALK 324 PDRKARAMLRSALRYM+ LK Sbjct: 674 PDRKARAMLRSALRYMERTLK 694