BLASTX nr result
ID: Mentha26_contig00025572
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00025572 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24043.1| hypothetical protein MIMGU_mgv1a0042091mg, partia... 55 8e-06 >gb|EYU24043.1| hypothetical protein MIMGU_mgv1a0042091mg, partial [Mimulus guttatus] Length = 237 Score = 55.5 bits (132), Expect = 8e-06 Identities = 20/33 (60%), Positives = 31/33 (93%) Frame = -2 Query: 352 GNWSWRVPQSMSFDSMTCEAERLKDMILLYGRL 254 GNWSWR+P+S +FDS++ EA++L+DM+++YGRL Sbjct: 197 GNWSWRIPKSRTFDSLSSEAQQLRDMLVMYGRL 229