BLASTX nr result
ID: Mentha26_contig00025319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00025319 (356 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF46306.1| ataxin-2 related protein [Ipomoea nil] 68 2e-09 gb|EPS71769.1| hypothetical protein M569_02990 [Genlisea aurea] 67 3e-09 ref|XP_006465955.1| PREDICTED: ataxin-2 homolog isoform X4 [Citr... 65 8e-09 ref|XP_006465952.1| PREDICTED: ataxin-2 homolog isoform X1 [Citr... 65 8e-09 ref|XP_006426616.1| hypothetical protein CICLE_v10025086mg [Citr... 65 8e-09 ref|XP_004235573.1| PREDICTED: uncharacterized protein LOC101259... 60 4e-07 ref|XP_004303672.1| PREDICTED: uncharacterized protein LOC101292... 59 5e-07 ref|XP_002275748.1| PREDICTED: uncharacterized protein LOC100265... 58 1e-06 ref|XP_006342950.1| PREDICTED: PAB1-binding protein 1-like [Sola... 58 2e-06 ref|XP_002303253.2| hydroxyproline-rich glycoprotein [Populus tr... 57 3e-06 ref|XP_007203769.1| hypothetical protein PRUPE_ppa002829mg [Prun... 56 5e-06 gb|EXB29676.1| hypothetical protein L484_013450 [Morus notabilis] 56 6e-06 ref|XP_004241859.1| PREDICTED: uncharacterized protein LOC101261... 56 6e-06 >dbj|BAF46306.1| ataxin-2 related protein [Ipomoea nil] Length = 616 Score = 67.8 bits (164), Expect = 2e-09 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 354 PYYHPNGPQYGQQMTVGQHRPVFYMPNYPHEMQYK*WEF 238 PYYHPNGPQYGQQM +G R V YMPNYPHEM +K +F Sbjct: 578 PYYHPNGPQYGQQMLLGHPRQVMYMPNYPHEMPHKGRDF 616 >gb|EPS71769.1| hypothetical protein M569_02990 [Genlisea aurea] Length = 500 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = -3 Query: 354 PYYHPNGPQYGQQMTVGQHRPVFYMPNYPHEMQYK*WEF 238 PYYHPNGPQYGQQM V Q RPVFYMP Y EM YK EF Sbjct: 462 PYYHPNGPQYGQQMMVRQPRPVFYMPTYAPEMPYKGREF 500 >ref|XP_006465955.1| PREDICTED: ataxin-2 homolog isoform X4 [Citrus sinensis] Length = 635 Score = 65.5 bits (158), Expect = 8e-09 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 351 YYHPNGPQYGQQMTVGQHRPVFYMPNYPHEMQYK 250 YYHP+GPQYGQQM VGQ RPVFY+PNY EM YK Sbjct: 598 YYHPHGPQYGQQMLVGQSRPVFYLPNYQPEMPYK 631 >ref|XP_006465952.1| PREDICTED: ataxin-2 homolog isoform X1 [Citrus sinensis] gi|568823086|ref|XP_006465953.1| PREDICTED: ataxin-2 homolog isoform X2 [Citrus sinensis] gi|568823088|ref|XP_006465954.1| PREDICTED: ataxin-2 homolog isoform X3 [Citrus sinensis] Length = 637 Score = 65.5 bits (158), Expect = 8e-09 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 351 YYHPNGPQYGQQMTVGQHRPVFYMPNYPHEMQYK 250 YYHP+GPQYGQQM VGQ RPVFY+PNY EM YK Sbjct: 600 YYHPHGPQYGQQMLVGQSRPVFYLPNYQPEMPYK 633 >ref|XP_006426616.1| hypothetical protein CICLE_v10025086mg [Citrus clementina] gi|557528606|gb|ESR39856.1| hypothetical protein CICLE_v10025086mg [Citrus clementina] Length = 665 Score = 65.5 bits (158), Expect = 8e-09 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 351 YYHPNGPQYGQQMTVGQHRPVFYMPNYPHEMQYK 250 YYHP+GPQYGQQM VGQ RPVFY+PNY EM YK Sbjct: 628 YYHPHGPQYGQQMLVGQSRPVFYLPNYQPEMPYK 661 >ref|XP_004235573.1| PREDICTED: uncharacterized protein LOC101259622 [Solanum lycopersicum] Length = 633 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -3 Query: 354 PYYHPNGPQYGQQMTVGQHRPVFYMPNYPHEMQYK 250 PY+HPNGPQYGQQM +G R V YMP YP E YK Sbjct: 594 PYFHPNGPQYGQQMMIGHPRQVVYMPTYPPESPYK 628 >ref|XP_004303672.1| PREDICTED: uncharacterized protein LOC101292616 [Fragaria vesca subsp. vesca] Length = 625 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 351 YYHPNGPQYGQQMTVGQHRPVFYMPNYPHEMQYK 250 YYHPNGPQYGQQM +G R V YMPNY EM YK Sbjct: 588 YYHPNGPQYGQQMLLGHPRQVVYMPNYQPEMPYK 621 >ref|XP_002275748.1| PREDICTED: uncharacterized protein LOC100265239 [Vitis vinifera] gi|297743028|emb|CBI35895.3| unnamed protein product [Vitis vinifera] Length = 631 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/38 (65%), Positives = 27/38 (71%) Frame = -3 Query: 351 YYHPNGPQYGQQMTVGQHRPVFYMPNYPHEMQYK*WEF 238 Y+HPNGPQYGQQM G R V YMP YP EM YK +F Sbjct: 594 YFHPNGPQYGQQMFFGHPRQVLYMPGYPPEMPYKGRDF 631 >ref|XP_006342950.1| PREDICTED: PAB1-binding protein 1-like [Solanum tuberosum] Length = 633 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -3 Query: 354 PYYHPNGPQYGQQMTVGQHRPVFYMPNYPHEMQY 253 PY+HPNGPQYGQQM +G R V YMP YP E Y Sbjct: 594 PYFHPNGPQYGQQMMIGHPRQVVYMPTYPPESPY 627 >ref|XP_002303253.2| hydroxyproline-rich glycoprotein [Populus trichocarpa] gi|550342525|gb|EEE78232.2| hydroxyproline-rich glycoprotein [Populus trichocarpa] Length = 524 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/38 (65%), Positives = 27/38 (71%) Frame = -3 Query: 351 YYHPNGPQYGQQMTVGQHRPVFYMPNYPHEMQYK*WEF 238 Y+HP GPQ+GQQM VG R V YMPNY EM YK EF Sbjct: 487 YFHPGGPQFGQQMLVGHPRQVLYMPNYQPEMPYKGREF 524 >ref|XP_007203769.1| hypothetical protein PRUPE_ppa002829mg [Prunus persica] gi|462399300|gb|EMJ04968.1| hypothetical protein PRUPE_ppa002829mg [Prunus persica] Length = 629 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = -3 Query: 351 YYHPNGPQYGQQMTVGQHRPVFYMPNYPHEMQYK 250 Y+HPNGPQYGQQM +G R V YMP+Y EM YK Sbjct: 592 YFHPNGPQYGQQMLLGHPRQVLYMPSYQPEMPYK 625 >gb|EXB29676.1| hypothetical protein L484_013450 [Morus notabilis] Length = 661 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -3 Query: 351 YYHPNGPQYGQQMTVGQHRPVFYMPNYPHEMQYK 250 Y+HPNGPQYGQQM +G R V YMP Y EM YK Sbjct: 624 YFHPNGPQYGQQMLLGHPRQVLYMPGYQPEMPYK 657 >ref|XP_004241859.1| PREDICTED: uncharacterized protein LOC101261127 [Solanum lycopersicum] Length = 623 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = -3 Query: 351 YYHPNGPQYGQQMTVGQHRPVFYMPNYPHEMQ 256 ++HPNGPQYGQQM +G R V YMPNYP EM+ Sbjct: 589 FFHPNGPQYGQQMMIGPPRQVVYMPNYPAEMR 620