BLASTX nr result
ID: Mentha26_contig00025315
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00025315 (469 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43611.1| hypothetical protein MIMGU_mgv1a003214mg [Mimulus... 78 1e-12 ref|XP_006346550.1| PREDICTED: CTP synthase-like isoform X1 [Sol... 65 7e-09 ref|XP_004229051.1| PREDICTED: CTP synthase-like [Solanum lycope... 65 7e-09 gb|AHM22928.1| CTP synthase [Nicotiana tabacum] 56 5e-06 >gb|EYU43611.1| hypothetical protein MIMGU_mgv1a003214mg [Mimulus guttatus] Length = 599 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = -2 Query: 468 DALLKKGTTRRLKMSNGSAPIKAHFYENATTLPNGALDGIYCNGNGLHV 322 DA+LKK + MSNGS+P+KAH YENAT L NG+LDGIYCNGN LHV Sbjct: 551 DAVLKKSAAKTCSMSNGSSPVKAHIYENATKLANGSLDGIYCNGNSLHV 599 >ref|XP_006346550.1| PREDICTED: CTP synthase-like isoform X1 [Solanum tuberosum] gi|565359509|ref|XP_006346551.1| PREDICTED: CTP synthase-like isoform X2 [Solanum tuberosum] Length = 599 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = -2 Query: 468 DALLKKGTTRRLKMSNGSAPIKAHFYENATTLPNGALDGIYCNGNGLHV 322 + LLKKG + +SNG++ +K+H Y N T + NG+LDGIYCNGNG+HV Sbjct: 551 ETLLKKGVPKTWSLSNGTSGLKSHRYVNGTKMANGSLDGIYCNGNGIHV 599 >ref|XP_004229051.1| PREDICTED: CTP synthase-like [Solanum lycopersicum] Length = 599 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = -2 Query: 468 DALLKKGTTRRLKMSNGSAPIKAHFYENATTLPNGALDGIYCNGNGLHV 322 + LLKKG + +SNG++ +K+H Y N T + NG+LDGIYCNGNG+HV Sbjct: 551 ETLLKKGVPKTWSLSNGTSGLKSHRYVNGTKMANGSLDGIYCNGNGIHV 599 >gb|AHM22928.1| CTP synthase [Nicotiana tabacum] Length = 599 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/49 (48%), Positives = 34/49 (69%) Frame = -2 Query: 468 DALLKKGTTRRLKMSNGSAPIKAHFYENATTLPNGALDGIYCNGNGLHV 322 + LKKG + +SNG++ +K+H Y N + L NG+LDGIY GNG+HV Sbjct: 551 ETFLKKGVPKTWGLSNGTSGLKSHRYVNGSKLANGSLDGIYSKGNGIHV 599