BLASTX nr result
ID: Mentha26_contig00025253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00025253 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS63168.1| hypothetical protein M569_11618, partial [Genlise... 59 9e-07 gb|EYU36875.1| hypothetical protein MIMGU_mgv1a018063mg [Mimulus... 58 2e-06 gb|EYU46058.1| hypothetical protein MIMGU_mgv1a000983mg [Mimulus... 57 3e-06 >gb|EPS63168.1| hypothetical protein M569_11618, partial [Genlisea aurea] Length = 873 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/34 (67%), Positives = 32/34 (94%) Frame = -1 Query: 306 RRSQWLDPREIEDEELPLTFADNMSIKNFSYKAK 205 RRS+W DPRE+E+EELPLTFAD +++KNF+++AK Sbjct: 839 RRSKWRDPREVEEEELPLTFADTVTVKNFTFRAK 872 >gb|EYU36875.1| hypothetical protein MIMGU_mgv1a018063mg [Mimulus guttatus] Length = 674 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -1 Query: 312 ESRRSQWLDPREIEDEELPLTFADNMSIKNFSYKAKTILKS 190 +S ++W DPREI DEELPLTFAD++SI+NFS +AK +KS Sbjct: 634 KSLTTKWSDPREIADEELPLTFADSVSIRNFSQRAKKTMKS 674 >gb|EYU46058.1| hypothetical protein MIMGU_mgv1a000983mg [Mimulus guttatus] Length = 923 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = -1 Query: 312 ESRRSQWLDPREIEDEELPLTFADNMSIKNFSYKAKTI 199 E+R ++W DPRE+ +EELPLTFAD++SIK+FS+K K I Sbjct: 883 ENRLNKWSDPREVAEEELPLTFADSLSIKHFSHKVKKI 920