BLASTX nr result
ID: Mentha26_contig00025228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00025228 (641 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS58687.1| hypothetical protein M569_16125 [Genlisea aurea] 56 8e-06 >gb|EPS58687.1| hypothetical protein M569_16125 [Genlisea aurea] Length = 97 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +2 Query: 203 TLRELGCTQLLLSLHRTVGGGTLTSHLASNVRAFCELSHGT 325 TL ELGCTQ L+ HR G L SHLA+N+R+FCELSHGT Sbjct: 51 TLGELGCTQSLMPFHRV--GARLNSHLAANLRSFCELSHGT 89