BLASTX nr result
ID: Mentha26_contig00025178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00025178 (475 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33813.1| hypothetical protein MIMGU_mgv1a003420mg [Mimulus... 69 9e-10 ref|XP_007213591.1| hypothetical protein PRUPE_ppa002750mg [Prun... 56 6e-06 ref|XP_006378622.1| hypothetical protein POPTR_0010s18400g [Popu... 55 8e-06 ref|XP_002315097.2| hypothetical protein POPTR_0010s18400g [Popu... 55 8e-06 >gb|EYU33813.1| hypothetical protein MIMGU_mgv1a003420mg [Mimulus guttatus] Length = 586 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -3 Query: 470 HRRTLYEHHKNVLHISPQEPTNDGPNWRFESLNKESLYNLS 348 HR TLY++HKN LHI+P EPTN+ PNWRFE ++K+S YNLS Sbjct: 544 HRTTLYKYHKNALHITPLEPTNELPNWRFEPISKDSAYNLS 584 >ref|XP_007213591.1| hypothetical protein PRUPE_ppa002750mg [Prunus persica] gi|462409456|gb|EMJ14790.1| hypothetical protein PRUPE_ppa002750mg [Prunus persica] Length = 637 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = -3 Query: 473 GHRRTLYEHHKNVLHISPQEPTNDGPNWRFESLNKESLYNLS 348 GHRRTLY+ HK LHIS +P++ NW+ +S+NK++LY LS Sbjct: 594 GHRRTLYDFHKKNLHISTVDPSSANRNWQIKSINKDTLYQLS 635 >ref|XP_006378622.1| hypothetical protein POPTR_0010s18400g [Populus trichocarpa] gi|550330079|gb|ERP56419.1| hypothetical protein POPTR_0010s18400g [Populus trichocarpa] Length = 782 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/41 (51%), Positives = 31/41 (75%) Frame = -3 Query: 473 GHRRTLYEHHKNVLHISPQEPTNDGPNWRFESLNKESLYNL 351 GHRRTLY+HH LHI+ +P+++ NW E +N++SLYN+ Sbjct: 739 GHRRTLYDHHNRNLHITTVDPSSNERNWHVEPINRDSLYNI 779 >ref|XP_002315097.2| hypothetical protein POPTR_0010s18400g [Populus trichocarpa] gi|550330078|gb|EEF01268.2| hypothetical protein POPTR_0010s18400g [Populus trichocarpa] Length = 759 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/41 (51%), Positives = 31/41 (75%) Frame = -3 Query: 473 GHRRTLYEHHKNVLHISPQEPTNDGPNWRFESLNKESLYNL 351 GHRRTLY+HH LHI+ +P+++ NW E +N++SLYN+ Sbjct: 716 GHRRTLYDHHNRNLHITTVDPSSNERNWHVEPINRDSLYNI 756