BLASTX nr result
ID: Mentha26_contig00024926
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00024926 (404 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007048377.1| Eukaryotic translation initiation factor 3 s... 45 6e-08 >ref|XP_007048377.1| Eukaryotic translation initiation factor 3 subunit A isoform 4 [Theobroma cacao] gi|508700638|gb|EOX92534.1| Eukaryotic translation initiation factor 3 subunit A isoform 4 [Theobroma cacao] Length = 779 Score = 45.4 bits (106), Expect(2) = 6e-08 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = +3 Query: 3 ERDRVRKEREETISNIIQSRKQEREAKRKMIYFL 104 E DR R+EREE IS IIQ+RK+ERE KRK I+++ Sbjct: 694 EFDRRREEREERISQIIQARKKEREFKRKKIFYV 727 Score = 37.0 bits (84), Expect(2) = 6e-08 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +1 Query: 154 EDLKRWRGERKRKPSERRSWTK*LKSRGSERENW 255 E+ ++ E K+K + R++W + LKSRG E ENW Sbjct: 741 EEARKLEDEGKKKLNARQNWMRLLKSRGRENENW 774