BLASTX nr result
ID: Mentha26_contig00024755
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00024755 (338 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38160.1| hypothetical protein MIMGU_mgv1a012058mg [Mimulus... 72 6e-11 ref|XP_006440863.1| hypothetical protein CICLE_v10021506mg [Citr... 55 8e-06 ref|XP_006440862.1| hypothetical protein CICLE_v10021506mg [Citr... 55 8e-06 >gb|EYU38160.1| hypothetical protein MIMGU_mgv1a012058mg [Mimulus guttatus] Length = 263 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -1 Query: 335 SREDDKSGIENEEEYAWLEEIDTPDDLYMRNGSYTGPRIEK 213 S+ED+KS +E EEEYAWL EIDTPDDLYMR+G+YTGP I K Sbjct: 223 SKEDEKSDVEKEEEYAWLSEIDTPDDLYMRSGTYTGPPIHK 263 >ref|XP_006440863.1| hypothetical protein CICLE_v10021506mg [Citrus clementina] gi|557543125|gb|ESR54103.1| hypothetical protein CICLE_v10021506mg [Citrus clementina] Length = 286 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/42 (64%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = -1 Query: 338 FSREDDKSGIENE-EEYAWLEEIDTPDDLYMRNGSYTGPRIE 216 FS +G +NE EEYAWL EIDTPDDLYMR G Y GP I+ Sbjct: 244 FSTFSAVNGADNEKEEYAWLSEIDTPDDLYMRPGVYAGPAIQ 285 >ref|XP_006440862.1| hypothetical protein CICLE_v10021506mg [Citrus clementina] gi|557543124|gb|ESR54102.1| hypothetical protein CICLE_v10021506mg [Citrus clementina] Length = 284 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/42 (64%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = -1 Query: 338 FSREDDKSGIENE-EEYAWLEEIDTPDDLYMRNGSYTGPRIE 216 FS +G +NE EEYAWL EIDTPDDLYMR G Y GP I+ Sbjct: 242 FSTFSAVNGADNEKEEYAWLSEIDTPDDLYMRPGVYAGPAIQ 283