BLASTX nr result
ID: Mentha26_contig00024475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00024475 (433 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007039082.1| Uncharacterized protein TCM_015432 [Theobrom... 56 5e-06 >ref|XP_007039082.1| Uncharacterized protein TCM_015432 [Theobroma cacao] gi|508776327|gb|EOY23583.1| Uncharacterized protein TCM_015432 [Theobroma cacao] Length = 98 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 432 MVYAALVVDKELQPDKVKRHMSVSDGKLSV 343 +VYAALVVDKELQPDKVKR MS+SDGKLSV Sbjct: 32 IVYAALVVDKELQPDKVKRQMSISDGKLSV 61