BLASTX nr result
ID: Mentha26_contig00024302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00024302 (388 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21948.1| hypothetical protein MIMGU_mgv1a0096341mg [Mimulu... 130 2e-28 ref|XP_006364278.1| PREDICTED: uncharacterized protein LOC102598... 122 4e-26 ref|XP_004245192.1| PREDICTED: uncharacterized protein LOC101262... 122 4e-26 ref|XP_007223355.1| hypothetical protein PRUPE_ppa007452mg [Prun... 121 1e-25 ref|XP_002284962.1| PREDICTED: uncharacterized protein LOC100252... 118 7e-25 ref|XP_002515557.1| conserved hypothetical protein [Ricinus comm... 115 5e-24 ref|XP_006483312.1| PREDICTED: uncharacterized protein LOC102608... 115 8e-24 ref|XP_004291483.1| PREDICTED: uncharacterized protein LOC101294... 115 8e-24 ref|XP_003544618.1| PREDICTED: uncharacterized protein LOC100776... 115 8e-24 gb|EXC26027.1| GTP-binding nuclear protein [Morus notabilis] 114 1e-23 gb|EXC12058.1| hypothetical protein L484_006602 [Morus notabilis] 114 2e-23 ref|XP_006450498.1| hypothetical protein CICLE_v10008711mg [Citr... 113 3e-23 ref|XP_007013814.1| Uncharacterized protein isoform 2 [Theobroma... 113 3e-23 ref|XP_007013813.1| Uncharacterized protein isoform 1 [Theobroma... 113 3e-23 ref|XP_006287989.1| hypothetical protein CARUB_v10001222mg [Caps... 113 3e-23 ref|XP_006412472.1| hypothetical protein EUTSA_v10025706mg [Eutr... 112 4e-23 ref|XP_006601137.1| PREDICTED: uncharacterized protein LOC100813... 112 4e-23 ref|XP_002871473.1| hypothetical protein ARALYDRAFT_487977 [Arab... 112 4e-23 dbj|BAD93922.1| hypothetical protein [Arabidopsis thaliana] 112 4e-23 ref|NP_196703.1| uncharacterized protein [Arabidopsis thaliana] ... 112 4e-23 >gb|EYU21948.1| hypothetical protein MIMGU_mgv1a0096341mg [Mimulus guttatus] Length = 336 Score = 130 bits (326), Expect = 2e-28 Identities = 62/70 (88%), Positives = 67/70 (95%) Frame = +1 Query: 1 AGRDTLKVPYESKGKGGFKRAVLRFVATTARTRIMFLSTYYHTRSDDFASLCGPVVDDVK 180 AGRDT+KVPYES+GKGG+KRAVLRFVA T RTRIMFLSTYYH RSDD+ASLCGPVVDDVK Sbjct: 266 AGRDTVKVPYESRGKGGYKRAVLRFVAPTNRTRIMFLSTYYHMRSDDYASLCGPVVDDVK 325 Query: 181 LLSVRNPRRL 210 LLSVRNPR+L Sbjct: 326 LLSVRNPRKL 335 >ref|XP_006364278.1| PREDICTED: uncharacterized protein LOC102598357 [Solanum tuberosum] Length = 371 Score = 122 bits (307), Expect = 4e-26 Identities = 59/70 (84%), Positives = 63/70 (90%) Frame = +1 Query: 1 AGRDTLKVPYESKGKGGFKRAVLRFVATTARTRIMFLSTYYHTRSDDFASLCGPVVDDVK 180 AGRDTLKVPYES GKGG+KRA+LRF AT +RTRIMFLSTYYHTRSDDF SLCGPVVDDV Sbjct: 301 AGRDTLKVPYESMGKGGYKRAILRFKATASRTRIMFLSTYYHTRSDDFVSLCGPVVDDVT 360 Query: 181 LLSVRNPRRL 210 LLSVR RR+ Sbjct: 361 LLSVRTHRRV 370 >ref|XP_004245192.1| PREDICTED: uncharacterized protein LOC101262737 [Solanum lycopersicum] Length = 371 Score = 122 bits (307), Expect = 4e-26 Identities = 59/70 (84%), Positives = 63/70 (90%) Frame = +1 Query: 1 AGRDTLKVPYESKGKGGFKRAVLRFVATTARTRIMFLSTYYHTRSDDFASLCGPVVDDVK 180 AGRDTLKVPYES GKGG+KRA+LRF AT +RTRIMFLSTYYHTRSDDF SLCGPVVDDV Sbjct: 301 AGRDTLKVPYESMGKGGYKRAILRFKATASRTRIMFLSTYYHTRSDDFVSLCGPVVDDVT 360 Query: 181 LLSVRNPRRL 210 LLSVR RR+ Sbjct: 361 LLSVRTHRRV 370 >ref|XP_007223355.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica] gi|462420291|gb|EMJ24554.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica] Length = 367 Score = 121 bits (303), Expect = 1e-25 Identities = 56/69 (81%), Positives = 65/69 (94%) Frame = +1 Query: 1 AGRDTLKVPYESKGKGGFKRAVLRFVATTARTRIMFLSTYYHTRSDDFASLCGPVVDDVK 180 AGRDT+KVPYESKGKGGFKRAVL+FVA + RTR+MFLSTYY RSDDF+SLCGPV+DDVK Sbjct: 299 AGRDTVKVPYESKGKGGFKRAVLKFVAVSTRTRVMFLSTYYTMRSDDFSSLCGPVLDDVK 358 Query: 181 LLSVRNPRR 207 LLS++NPR+ Sbjct: 359 LLSLKNPRQ 367 >ref|XP_002284962.1| PREDICTED: uncharacterized protein LOC100252479 [Vitis vinifera] Length = 368 Score = 118 bits (296), Expect = 7e-25 Identities = 57/69 (82%), Positives = 63/69 (91%) Frame = +1 Query: 1 AGRDTLKVPYESKGKGGFKRAVLRFVATTARTRIMFLSTYYHTRSDDFASLCGPVVDDVK 180 AGRDT+KVPYESKGKGGFKRAVLRFVA + RTRIMFLST+Y RSDD+ASLCGPV+DDVK Sbjct: 298 AGRDTIKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDYASLCGPVLDDVK 357 Query: 181 LLSVRNPRR 207 LLS+R P R Sbjct: 358 LLSLRTPPR 366 >ref|XP_002515557.1| conserved hypothetical protein [Ricinus communis] gi|1621268|emb|CAB02653.1| unknown [Ricinus communis] gi|223545501|gb|EEF47006.1| conserved hypothetical protein [Ricinus communis] Length = 364 Score = 115 bits (289), Expect = 5e-24 Identities = 56/67 (83%), Positives = 60/67 (89%) Frame = +1 Query: 1 AGRDTLKVPYESKGKGGFKRAVLRFVATTARTRIMFLSTYYHTRSDDFASLCGPVVDDVK 180 AG+DTLKVPYESKGKGGFKRAVLRFVA RTRIMF ST+Y RSDDF+SLCGPV+DDVK Sbjct: 298 AGKDTLKVPYESKGKGGFKRAVLRFVAVANRTRIMFYSTFYTMRSDDFSSLCGPVLDDVK 357 Query: 181 LLSVRNP 201 LLSVR P Sbjct: 358 LLSVRKP 364 >ref|XP_006483312.1| PREDICTED: uncharacterized protein LOC102608149 [Citrus sinensis] Length = 366 Score = 115 bits (287), Expect = 8e-24 Identities = 55/66 (83%), Positives = 61/66 (92%) Frame = +1 Query: 1 AGRDTLKVPYESKGKGGFKRAVLRFVATTARTRIMFLSTYYHTRSDDFASLCGPVVDDVK 180 AG+ T+KVPYESKGKGGFKRAVLRFVA + RTRIMFLST+Y RSDDF+SLCGPV+DDVK Sbjct: 299 AGKGTIKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDFSSLCGPVIDDVK 358 Query: 181 LLSVRN 198 LLSVRN Sbjct: 359 LLSVRN 364 >ref|XP_004291483.1| PREDICTED: uncharacterized protein LOC101294330 [Fragaria vesca subsp. vesca] Length = 368 Score = 115 bits (287), Expect = 8e-24 Identities = 55/69 (79%), Positives = 62/69 (89%) Frame = +1 Query: 1 AGRDTLKVPYESKGKGGFKRAVLRFVATTARTRIMFLSTYYHTRSDDFASLCGPVVDDVK 180 AGRDT+KVPYESKGKGGFKRAVL+F A RTRIMFLST+Y RSDDF+SLCGPV+DDVK Sbjct: 300 AGRDTIKVPYESKGKGGFKRAVLKFRAVGPRTRIMFLSTFYTMRSDDFSSLCGPVLDDVK 359 Query: 181 LLSVRNPRR 207 LLS+R PR+ Sbjct: 360 LLSLRRPRQ 368 >ref|XP_003544618.1| PREDICTED: uncharacterized protein LOC100776765 [Glycine max] Length = 366 Score = 115 bits (287), Expect = 8e-24 Identities = 53/67 (79%), Positives = 61/67 (91%) Frame = +1 Query: 1 AGRDTLKVPYESKGKGGFKRAVLRFVATTARTRIMFLSTYYHTRSDDFASLCGPVVDDVK 180 AG+DT+KVPYESKGKGGFKRA L+FVA T RTRIMFLST+Y RSDDF+SLCGPV+DDVK Sbjct: 300 AGKDTIKVPYESKGKGGFKRAALKFVAVTPRTRIMFLSTFYTMRSDDFSSLCGPVIDDVK 359 Query: 181 LLSVRNP 201 L+S+R P Sbjct: 360 LVSLRKP 366 >gb|EXC26027.1| GTP-binding nuclear protein [Morus notabilis] Length = 573 Score = 114 bits (285), Expect = 1e-23 Identities = 54/70 (77%), Positives = 61/70 (87%) Frame = +1 Query: 1 AGRDTLKVPYESKGKGGFKRAVLRFVATTARTRIMFLSTYYHTRSDDFASLCGPVVDDVK 180 AGR T+KVPYESKGKGGFKR VL FVAT RTRIMFLST+Y RSDDF+SLCGPV+DD+K Sbjct: 297 AGRATVKVPYESKGKGGFKRGVLTFVATETRTRIMFLSTFYSMRSDDFSSLCGPVLDDIK 356 Query: 181 LLSVRNPRRL 210 LLSVR P ++ Sbjct: 357 LLSVRKPNQI 366 >gb|EXC12058.1| hypothetical protein L484_006602 [Morus notabilis] Length = 217 Score = 114 bits (284), Expect = 2e-23 Identities = 54/68 (79%), Positives = 60/68 (88%) Frame = +1 Query: 1 AGRDTLKVPYESKGKGGFKRAVLRFVATTARTRIMFLSTYYHTRSDDFASLCGPVVDDVK 180 AGR T+KVPYESKGKGGFKR VL FVAT RTRIMFLST+Y RSDDF+SLCGPV+DD+K Sbjct: 150 AGRATVKVPYESKGKGGFKRGVLTFVATETRTRIMFLSTFYSMRSDDFSSLCGPVLDDIK 209 Query: 181 LLSVRNPR 204 LLSVR P+ Sbjct: 210 LLSVRKPK 217 >ref|XP_006450498.1| hypothetical protein CICLE_v10008711mg [Citrus clementina] gi|557553724|gb|ESR63738.1| hypothetical protein CICLE_v10008711mg [Citrus clementina] Length = 366 Score = 113 bits (282), Expect = 3e-23 Identities = 54/66 (81%), Positives = 61/66 (92%) Frame = +1 Query: 1 AGRDTLKVPYESKGKGGFKRAVLRFVATTARTRIMFLSTYYHTRSDDFASLCGPVVDDVK 180 AG+ T+KVPYESKGKGGFKRAVLRFVA + RTRIMFLST+Y RSDDF+SLCGPV+DDVK Sbjct: 299 AGKGTIKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDFSSLCGPVIDDVK 358 Query: 181 LLSVRN 198 LLSVR+ Sbjct: 359 LLSVRS 364 >ref|XP_007013814.1| Uncharacterized protein isoform 2 [Theobroma cacao] gi|508784177|gb|EOY31433.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 375 Score = 113 bits (282), Expect = 3e-23 Identities = 55/67 (82%), Positives = 59/67 (88%) Frame = +1 Query: 1 AGRDTLKVPYESKGKGGFKRAVLRFVATTARTRIMFLSTYYHTRSDDFASLCGPVVDDVK 180 AG+DTLKVPYESKG GGFKRAVL F A + RTRIMFLST+Y RSDDF+SLCGPVVDDVK Sbjct: 309 AGKDTLKVPYESKGTGGFKRAVLTFKAVSTRTRIMFLSTFYTMRSDDFSSLCGPVVDDVK 368 Query: 181 LLSVRNP 201 LLSVR P Sbjct: 369 LLSVRKP 375 >ref|XP_007013813.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508784176|gb|EOY31432.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 412 Score = 113 bits (282), Expect = 3e-23 Identities = 55/67 (82%), Positives = 59/67 (88%) Frame = +1 Query: 1 AGRDTLKVPYESKGKGGFKRAVLRFVATTARTRIMFLSTYYHTRSDDFASLCGPVVDDVK 180 AG+DTLKVPYESKG GGFKRAVL F A + RTRIMFLST+Y RSDDF+SLCGPVVDDVK Sbjct: 346 AGKDTLKVPYESKGTGGFKRAVLTFKAVSTRTRIMFLSTFYTMRSDDFSSLCGPVVDDVK 405 Query: 181 LLSVRNP 201 LLSVR P Sbjct: 406 LLSVRKP 412 >ref|XP_006287989.1| hypothetical protein CARUB_v10001222mg [Capsella rubella] gi|482556695|gb|EOA20887.1| hypothetical protein CARUB_v10001222mg [Capsella rubella] Length = 367 Score = 113 bits (282), Expect = 3e-23 Identities = 53/67 (79%), Positives = 59/67 (88%) Frame = +1 Query: 1 AGRDTLKVPYESKGKGGFKRAVLRFVATTARTRIMFLSTYYHTRSDDFASLCGPVVDDVK 180 AGRDTLKVPYES+GKGGFKRA +RFVA + RTRIMF ST+Y RSDDF+SLCGPV+DDVK Sbjct: 301 AGRDTLKVPYESRGKGGFKRATMRFVAVSNRTRIMFYSTFYAMRSDDFSSLCGPVIDDVK 360 Query: 181 LLSVRNP 201 LL VR P Sbjct: 361 LLGVRKP 367 >ref|XP_006412472.1| hypothetical protein EUTSA_v10025706mg [Eutrema salsugineum] gi|557113642|gb|ESQ53925.1| hypothetical protein EUTSA_v10025706mg [Eutrema salsugineum] Length = 325 Score = 112 bits (281), Expect = 4e-23 Identities = 52/67 (77%), Positives = 59/67 (88%) Frame = +1 Query: 1 AGRDTLKVPYESKGKGGFKRAVLRFVATTARTRIMFLSTYYHTRSDDFASLCGPVVDDVK 180 AG+DT+KVPYESKGKGGFKRA LRFVA +ARTR+MF ST+Y R DDF+SLCGPV+DDVK Sbjct: 259 AGKDTIKVPYESKGKGGFKRASLRFVAVSARTRVMFYSTFYAMREDDFSSLCGPVIDDVK 318 Query: 181 LLSVRNP 201 LLS R P Sbjct: 319 LLSARRP 325 >ref|XP_006601137.1| PREDICTED: uncharacterized protein LOC100813910 isoform X1 [Glycine max] gi|571538334|ref|XP_006601138.1| PREDICTED: uncharacterized protein LOC100813910 isoform X2 [Glycine max] Length = 366 Score = 112 bits (281), Expect = 4e-23 Identities = 51/67 (76%), Positives = 60/67 (89%) Frame = +1 Query: 1 AGRDTLKVPYESKGKGGFKRAVLRFVATTARTRIMFLSTYYHTRSDDFASLCGPVVDDVK 180 AG+DT+KVPYESKG GGFKRA L+FVA T RTR+MFLST+Y RSDDF+SLCGPV+DDVK Sbjct: 300 AGKDTIKVPYESKGNGGFKRAALKFVAVTPRTRVMFLSTFYTMRSDDFSSLCGPVIDDVK 359 Query: 181 LLSVRNP 201 L+S+R P Sbjct: 360 LVSLRKP 366 >ref|XP_002871473.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. lyrata] gi|297317310|gb|EFH47732.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. lyrata] Length = 366 Score = 112 bits (281), Expect = 4e-23 Identities = 52/67 (77%), Positives = 59/67 (88%) Frame = +1 Query: 1 AGRDTLKVPYESKGKGGFKRAVLRFVATTARTRIMFLSTYYHTRSDDFASLCGPVVDDVK 180 AG+DTLKVPYES+GKGGFKRA LRFVA + RTR+MF ST+Y RSDDF+SLCGPV+DDVK Sbjct: 300 AGKDTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSSLCGPVIDDVK 359 Query: 181 LLSVRNP 201 LLS R P Sbjct: 360 LLSARKP 366 >dbj|BAD93922.1| hypothetical protein [Arabidopsis thaliana] Length = 73 Score = 112 bits (281), Expect = 4e-23 Identities = 52/67 (77%), Positives = 59/67 (88%) Frame = +1 Query: 1 AGRDTLKVPYESKGKGGFKRAVLRFVATTARTRIMFLSTYYHTRSDDFASLCGPVVDDVK 180 AG+DTLKVPYES+GKGGFKRA LRFVA + RTR+MF ST+Y RSDDF+SLCGPV+DDVK Sbjct: 7 AGKDTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSSLCGPVIDDVK 66 Query: 181 LLSVRNP 201 LLS R P Sbjct: 67 LLSARKP 73 >ref|NP_196703.1| uncharacterized protein [Arabidopsis thaliana] gi|7573399|emb|CAB87702.1| putative protein [Arabidopsis thaliana] gi|15028265|gb|AAK76721.1| unknown protein [Arabidopsis thaliana] gi|20465273|gb|AAM20000.1| unknown protein [Arabidopsis thaliana] gi|332004294|gb|AED91677.1| uncharacterized protein AT5G11420 [Arabidopsis thaliana] Length = 366 Score = 112 bits (281), Expect = 4e-23 Identities = 52/67 (77%), Positives = 59/67 (88%) Frame = +1 Query: 1 AGRDTLKVPYESKGKGGFKRAVLRFVATTARTRIMFLSTYYHTRSDDFASLCGPVVDDVK 180 AG+DTLKVPYES+GKGGFKRA LRFVA + RTR+MF ST+Y RSDDF+SLCGPV+DDVK Sbjct: 300 AGKDTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSSLCGPVIDDVK 359 Query: 181 LLSVRNP 201 LLS R P Sbjct: 360 LLSARKP 366