BLASTX nr result
ID: Mentha26_contig00024269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00024269 (358 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI14900.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|XP_002278192.1| PREDICTED: BTB/POZ and TAZ domain-containing... 59 5e-07 ref|XP_006351442.1| PREDICTED: BTB/POZ and TAZ domain-containing... 56 6e-06 >emb|CBI14900.3| unnamed protein product [Vitis vinifera] Length = 347 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/48 (66%), Positives = 38/48 (79%), Gaps = 4/48 (8%) Frame = -3 Query: 356 GNDARWRLLVKKVVSARTISSLSIPKRKREDVPRVAL-HRE---SFRL 225 G DARW+LLV+KVVSA+ +SSLS+PKRKRE+ PR L HR SFRL Sbjct: 300 GEDARWKLLVRKVVSAKAMSSLSLPKRKREEEPRQTLDHRHGLGSFRL 347 >ref|XP_002278192.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Vitis vinifera] Length = 351 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/48 (66%), Positives = 38/48 (79%), Gaps = 4/48 (8%) Frame = -3 Query: 356 GNDARWRLLVKKVVSARTISSLSIPKRKREDVPRVAL-HRE---SFRL 225 G DARW+LLV+KVVSA+ +SSLS+PKRKRE+ PR L HR SFRL Sbjct: 304 GEDARWKLLVRKVVSAKAMSSLSLPKRKREEEPRQTLDHRHGLGSFRL 351 >ref|XP_006351442.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum tuberosum] Length = 345 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = -3 Query: 356 GNDARWRLLVKKVVSARTISSLSIPKRKREDVPRVALHRESFR 228 G+D W+ LV+KVVSAR +SSLS+PKRKRE+ P++ LH R Sbjct: 295 GDDGLWKSLVEKVVSARALSSLSLPKRKREEEPKMNLHHHQVR 337