BLASTX nr result
ID: Mentha26_contig00024201
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00024201 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41579.1| hypothetical protein MIMGU_mgv1a004062mg [Mimulus... 59 9e-07 >gb|EYU41579.1| hypothetical protein MIMGU_mgv1a004062mg [Mimulus guttatus] Length = 546 Score = 58.5 bits (140), Expect = 9e-07 Identities = 37/73 (50%), Positives = 42/73 (57%), Gaps = 7/73 (9%) Frame = -2 Query: 203 MSTTFSLSAFSPITH------HRLR-SPAPRFSVKNSADXXXXXXXXXXTSWVSPDWLTS 45 MS + SLS+ S TH HR R SP+P SVKNS SWVSPDWLTS Sbjct: 1 MSFSLSLSSLSTTTHRRRLHRHRHRHSPSPSLSVKNSTGNKPPLPPTKPKSWVSPDWLTS 60 Query: 44 LTKSLATLGPKDE 6 LTKSL+ PKD+ Sbjct: 61 LTKSLS---PKDD 70