BLASTX nr result
ID: Mentha26_contig00023592
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00023592 (793 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002314911.1| pentatricopeptide repeat-containing family p... 60 7e-07 ref|XP_002267613.1| PREDICTED: putative pentatricopeptide repeat... 57 8e-06 >ref|XP_002314911.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222863951|gb|EEF01082.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 743 Score = 60.5 bits (145), Expect = 7e-07 Identities = 26/59 (44%), Positives = 40/59 (67%) Frame = +3 Query: 375 NDLITGHYTRNNSTYESYVFDQMRKQNSFYWNTILSVYPKQGDVASMNKMFTSITRKDG 551 N+LI + N TY +VFD+M + NSF WNT+LS Y K GD+++M ++F+ + +DG Sbjct: 44 NNLINAYSKLGNITYARHVFDKMPQPNSFSWNTMLSAYSKSGDLSTMQEIFSIMPNRDG 102 >ref|XP_002267613.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g68930 [Vitis vinifera] gi|297738214|emb|CBI27415.3| unnamed protein product [Vitis vinifera] Length = 743 Score = 57.0 bits (136), Expect = 8e-06 Identities = 26/61 (42%), Positives = 39/61 (63%) Frame = +3 Query: 369 ITNDLITGHYTRNNSTYESYVFDQMRKQNSFYWNTILSVYPKQGDVASMNKMFTSITRKD 548 ++N+LIT +Y N Y +VFD + + N F WNTILSVY K G ++ M ++F + +D Sbjct: 42 LSNNLITAYYKLGNLAYAHHVFDHIPQPNLFSWNTILSVYSKLGLLSQMQQIFNLMPFRD 101 Query: 549 G 551 G Sbjct: 102 G 102