BLASTX nr result
ID: Mentha26_contig00023416
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00023416 (360 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB63696.1| hypothetical protein L484_027041 [Morus notabilis] 65 1e-08 gb|EXC19492.1| hypothetical protein L484_014122 [Morus notabilis] 64 3e-08 ref|XP_003556214.1| PREDICTED: Golgi to ER traffic protein 4 hom... 62 6e-08 gb|EXB88461.1| hypothetical protein L484_012903 [Morus notabilis] 62 8e-08 ref|XP_007218338.1| hypothetical protein PRUPE_ppa008591mg [Prun... 62 8e-08 ref|XP_006364258.1| PREDICTED: Golgi to ER traffic protein 4 hom... 62 1e-07 ref|XP_006436210.1| hypothetical protein CICLE_v10032131mg [Citr... 62 1e-07 ref|XP_004244790.1| PREDICTED: Golgi to ER traffic protein 4 hom... 62 1e-07 ref|XP_002315277.1| hypothetical protein POPTR_0010s22440g [Popu... 62 1e-07 gb|EYU42724.1| hypothetical protein MIMGU_mgv1a009970mg [Mimulus... 61 1e-07 ref|XP_007143670.1| hypothetical protein PHAVU_007G091600g [Phas... 61 2e-07 ref|NP_001239772.1| uncharacterized protein LOC100780059 [Glycin... 61 2e-07 ref|XP_002523898.1| conserved hypothetical protein [Ricinus comm... 60 4e-07 ref|XP_004307417.1| PREDICTED: Golgi to ER traffic protein 4 hom... 57 3e-06 ref|XP_004252154.1| PREDICTED: Golgi to ER traffic protein 4 hom... 56 5e-06 ref|XP_004496342.1| PREDICTED: Golgi to ER traffic protein 4 hom... 55 8e-06 ref|XP_004496340.1| PREDICTED: Golgi to ER traffic protein 4 hom... 55 8e-06 >gb|EXB63696.1| hypothetical protein L484_027041 [Morus notabilis] Length = 354 Score = 65.1 bits (157), Expect = 1e-08 Identities = 34/61 (55%), Positives = 47/61 (77%) Frame = -1 Query: 183 VYLSFLLETVPPNSKP*TINSTQKSMSRERTRRAALPPAEENIEKIKKVVDEGNFYGAQQ 4 V ++ L+E V + +P I+ K+MSRER +R LPPA+ENIEK+KKV++EGN+YGAQQ Sbjct: 2 VLMTLLVEEVE-DDEPLQIS---KAMSRERPKRGVLPPAQENIEKLKKVLEEGNYYGAQQ 57 Query: 3 M 1 M Sbjct: 58 M 58 >gb|EXC19492.1| hypothetical protein L484_014122 [Morus notabilis] Length = 339 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -1 Query: 108 MSRERTRRAALPPAEENIEKIKKVVDEGNFYGAQQM 1 MSRER +R LPPA+ENIEK+KKVV+EGN+YGAQQM Sbjct: 1 MSRERPKRGVLPPAQENIEKLKKVVEEGNYYGAQQM 36 >ref|XP_003556214.1| PREDICTED: Golgi to ER traffic protein 4 homolog isoform X1 [Glycine max] Length = 323 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/36 (75%), Positives = 35/36 (97%) Frame = -1 Query: 108 MSRERTRRAALPPAEENIEKIKKVVDEGNFYGAQQM 1 MSR+R+RRA LPPA+ENIEK++KVV++GN+YGAQQM Sbjct: 1 MSRQRSRRAELPPAQENIEKLEKVVNDGNYYGAQQM 36 >gb|EXB88461.1| hypothetical protein L484_012903 [Morus notabilis] Length = 149 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -1 Query: 114 KSMSRERTRRAALPPAEENIEKIKKVVDEGNFYGAQQM 1 K+MSRER +R LP A+ENIEK+KKVV+EGN+YGAQQM Sbjct: 51 KAMSRERPKRGVLPLAQENIEKLKKVVEEGNYYGAQQM 88 >ref|XP_007218338.1| hypothetical protein PRUPE_ppa008591mg [Prunus persica] gi|462414800|gb|EMJ19537.1| hypothetical protein PRUPE_ppa008591mg [Prunus persica] Length = 326 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 108 MSRERTRRAALPPAEENIEKIKKVVDEGNFYGAQQM 1 MSRER +R LPPA+ENIEK++KVV+EGN+YGAQQM Sbjct: 1 MSRERPKRGTLPPAQENIEKLEKVVEEGNYYGAQQM 36 >ref|XP_006364258.1| PREDICTED: Golgi to ER traffic protein 4 homolog [Solanum tuberosum] Length = 328 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 108 MSRERTRRAALPPAEENIEKIKKVVDEGNFYGAQQM 1 MSRER +RA LPPA+ENIEK++KVV +GN+YGAQQM Sbjct: 1 MSRERAKRATLPPAQENIEKLEKVVKQGNYYGAQQM 36 >ref|XP_006436210.1| hypothetical protein CICLE_v10032131mg [Citrus clementina] gi|568865133|ref|XP_006485932.1| PREDICTED: Golgi to ER traffic protein 4 homolog [Citrus sinensis] gi|557538406|gb|ESR49450.1| hypothetical protein CICLE_v10032131mg [Citrus clementina] Length = 321 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/36 (72%), Positives = 34/36 (94%) Frame = -1 Query: 108 MSRERTRRAALPPAEENIEKIKKVVDEGNFYGAQQM 1 MSR+R +R ALPPA+ENI+K++K+V+EGNFYGAQQM Sbjct: 1 MSRQRPKRTALPPAQENIDKLEKIVNEGNFYGAQQM 36 >ref|XP_004244790.1| PREDICTED: Golgi to ER traffic protein 4 homolog [Solanum lycopersicum] Length = 328 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 108 MSRERTRRAALPPAEENIEKIKKVVDEGNFYGAQQM 1 MSRER +RA LPPA+ENIEK++KVV +GN+YGAQQM Sbjct: 1 MSRERAKRATLPPAQENIEKLEKVVKQGNYYGAQQM 36 >ref|XP_002315277.1| hypothetical protein POPTR_0010s22440g [Populus trichocarpa] gi|222864317|gb|EEF01448.1| hypothetical protein POPTR_0010s22440g [Populus trichocarpa] Length = 322 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 108 MSRERTRRAALPPAEENIEKIKKVVDEGNFYGAQQM 1 MSRER RRA LPPAEENI+K++ V++EGN+YGAQQM Sbjct: 1 MSRERPRRATLPPAEENIKKLENVINEGNYYGAQQM 36 >gb|EYU42724.1| hypothetical protein MIMGU_mgv1a009970mg [Mimulus guttatus] Length = 326 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -1 Query: 108 MSRERTRRAALPPAEENIEKIKKVVDEGNFYGAQQM 1 MSRER +R AL PA+ENI+KIKKVVDEGN YGAQQM Sbjct: 1 MSRERAKRIALAPAQENIDKIKKVVDEGNCYGAQQM 36 >ref|XP_007143670.1| hypothetical protein PHAVU_007G091600g [Phaseolus vulgaris] gi|543177247|gb|AGV54645.1| golgi to ER traffic protein 4 [Phaseolus vulgaris] gi|561016860|gb|ESW15664.1| hypothetical protein PHAVU_007G091600g [Phaseolus vulgaris] Length = 323 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/36 (72%), Positives = 34/36 (94%) Frame = -1 Query: 108 MSRERTRRAALPPAEENIEKIKKVVDEGNFYGAQQM 1 MSR+R+R+ LPPA+ENIEK++KVV+EGN+YGAQQM Sbjct: 1 MSRQRSRKVELPPAQENIEKLEKVVNEGNYYGAQQM 36 >ref|NP_001239772.1| uncharacterized protein LOC100780059 [Glycine max] gi|255636423|gb|ACU18550.1| unknown [Glycine max] Length = 323 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/36 (72%), Positives = 34/36 (94%) Frame = -1 Query: 108 MSRERTRRAALPPAEENIEKIKKVVDEGNFYGAQQM 1 MSR+R+RR LPPA+ENIEK++KVV++GN+YGAQQM Sbjct: 1 MSRQRSRRVELPPAQENIEKLEKVVNDGNYYGAQQM 36 >ref|XP_002523898.1| conserved hypothetical protein [Ricinus communis] gi|223536828|gb|EEF38467.1| conserved hypothetical protein [Ricinus communis] Length = 324 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -1 Query: 108 MSRERTRRAALPPAEENIEKIKKVVDEGNFYGAQQM 1 MSRER RRA LPP +ENIEK++ V++EGN+YGAQQM Sbjct: 1 MSRERPRRANLPPVQENIEKLENVINEGNYYGAQQM 36 >ref|XP_004307417.1| PREDICTED: Golgi to ER traffic protein 4 homolog [Fragaria vesca subsp. vesca] Length = 327 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -1 Query: 108 MSRERTRRAALPPAEENIEKIKKVVDEGNFYGAQQM 1 MS+ER +R LPPA+E IEK +KVV+EGN+YGAQQ+ Sbjct: 1 MSKERAKRGTLPPAQEQIEKFEKVVEEGNYYGAQQL 36 >ref|XP_004252154.1| PREDICTED: Golgi to ER traffic protein 4 homolog [Solanum lycopersicum] Length = 380 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -1 Query: 108 MSRERTRRAALPPAEENIEKIKKVVDEGNFYGAQQM 1 M RER RR PPA+ENI+K++KVV EGN+YGAQQM Sbjct: 1 MFRERVRRVIQPPAQENIDKLEKVVKEGNYYGAQQM 36 >ref|XP_004496342.1| PREDICTED: Golgi to ER traffic protein 4 homolog isoform X3 [Cicer arietinum] Length = 323 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = -1 Query: 108 MSRERTRRAALPPAEENIEKIKKVVDEGNFYGAQQM 1 MSR R++R LPP +EN++K++KVV +GNFYGAQQM Sbjct: 1 MSRPRSKRIELPPVQENVDKLEKVVKDGNFYGAQQM 36 >ref|XP_004496340.1| PREDICTED: Golgi to ER traffic protein 4 homolog isoform X1 [Cicer arietinum] Length = 373 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = -1 Query: 108 MSRERTRRAALPPAEENIEKIKKVVDEGNFYGAQQM 1 MSR R++R LPP +EN++K++KVV +GNFYGAQQM Sbjct: 1 MSRPRSKRIELPPVQENVDKLEKVVKDGNFYGAQQM 36