BLASTX nr result
ID: Mentha26_contig00023344
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00023344 (515 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19784.1| hypothetical protein MIMGU_mgv1a006484mg [Mimulus... 63 4e-08 gb|EPS63270.1| hypothetical protein M569_11515, partial [Genlise... 62 1e-07 ref|XP_006361454.1| PREDICTED: hippocampus abundant transcript-l... 60 3e-07 ref|XP_004249978.1| PREDICTED: hippocampus abundant transcript-l... 59 7e-07 ref|XP_007010349.1| Major facilitator superfamily protein isofor... 55 8e-06 ref|XP_007010348.1| Major facilitator superfamily protein isofor... 55 8e-06 ref|XP_007010347.1| Major facilitator superfamily protein isofor... 55 8e-06 ref|XP_004250476.1| PREDICTED: hippocampus abundant transcript-l... 55 8e-06 >gb|EYU19784.1| hypothetical protein MIMGU_mgv1a006484mg [Mimulus guttatus] Length = 442 Score = 63.2 bits (152), Expect = 4e-08 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Frame = +3 Query: 3 SNAPFNCKGFSIIVATLSTVVALYFAWTLNL-DTPPKNTTDESTEDVETPLLS 158 SNAPF+CKGFSII A+LS VV+ FA TLNL D PP T + ED+ETPLLS Sbjct: 393 SNAPFDCKGFSIIFASLSMVVSFCFACTLNLEDAPP---TKKGLEDIETPLLS 442 >gb|EPS63270.1| hypothetical protein M569_11515, partial [Genlisea aurea] Length = 117 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/54 (55%), Positives = 37/54 (68%), Gaps = 2/54 (3%) Frame = +3 Query: 3 SNAPFNCKGFSIIVATLSTVVALYFAWTLNLDTPPKNTT--DESTEDVETPLLS 158 S APFNCKGFSI++A+L V++ + A TLNL PK + D S ED E PLLS Sbjct: 64 SRAPFNCKGFSIVIASLGIVISFFLASTLNLQASPKKSAAEDRSEEDCEAPLLS 117 >ref|XP_006361454.1| PREDICTED: hippocampus abundant transcript-like protein 1-like [Solanum tuberosum] Length = 441 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/51 (52%), Positives = 39/51 (76%) Frame = +3 Query: 6 NAPFNCKGFSIIVATLSTVVALYFAWTLNLDTPPKNTTDESTEDVETPLLS 158 +APFNCKGFSI+ A+L VV+L +A TL ++ P + T DE+ E++E PLL+ Sbjct: 391 DAPFNCKGFSILCASLCMVVSLCYASTLKVEAPRERTFDENAENIEAPLLT 441 >ref|XP_004249978.1| PREDICTED: hippocampus abundant transcript-like protein 1-like [Solanum lycopersicum] Length = 441 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/51 (52%), Positives = 38/51 (74%) Frame = +3 Query: 6 NAPFNCKGFSIIVATLSTVVALYFAWTLNLDTPPKNTTDESTEDVETPLLS 158 +APFNCKGFSI+ A+L VV+L +A TL ++ P + T DE E++E PLL+ Sbjct: 391 DAPFNCKGFSILCASLCMVVSLCYASTLKVEAPRERTFDEIAENIEAPLLT 441 >ref|XP_007010349.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao] gi|590566852|ref|XP_007010350.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao] gi|508727262|gb|EOY19159.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao] gi|508727263|gb|EOY19160.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao] Length = 374 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = +3 Query: 3 SNAPFNCKGFSIIVATLSTVVALYFAWTLNLDTPPKNTTDESTEDVETPLLS 158 SNAPFNCKGFSIIVA++ V++L FA L P +N+ E+ ED+E LLS Sbjct: 324 SNAPFNCKGFSIIVASICLVISLCFACLLQ---PGENSIQETEEDMEASLLS 372 >ref|XP_007010348.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao] gi|508727261|gb|EOY19158.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao] Length = 447 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = +3 Query: 3 SNAPFNCKGFSIIVATLSTVVALYFAWTLNLDTPPKNTTDESTEDVETPLLS 158 SNAPFNCKGFSIIVA++ V++L FA L P +N+ E+ ED+E LLS Sbjct: 397 SNAPFNCKGFSIIVASICLVISLCFACLLQ---PGENSIQETEEDMEASLLS 445 >ref|XP_007010347.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao] gi|508727260|gb|EOY19157.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao] Length = 509 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = +3 Query: 3 SNAPFNCKGFSIIVATLSTVVALYFAWTLNLDTPPKNTTDESTEDVETPLLS 158 SNAPFNCKGFSIIVA++ V++L FA L P +N+ E+ ED+E LLS Sbjct: 459 SNAPFNCKGFSIIVASICLVISLCFACLLQ---PGENSIQETEEDMEASLLS 507 >ref|XP_004250476.1| PREDICTED: hippocampus abundant transcript-like protein 1-like [Solanum lycopersicum] Length = 439 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/52 (51%), Positives = 35/52 (67%) Frame = +3 Query: 3 SNAPFNCKGFSIIVATLSTVVALYFAWTLNLDTPPKNTTDESTEDVETPLLS 158 SNAPFNCKGFS+I A + +A YFAW L +T +E+ E +ETPLL+ Sbjct: 391 SNAPFNCKGFSLICAAFALAMAFYFAWIL---PEAPSTHEENGESMETPLLA 439