BLASTX nr result
ID: Mentha26_contig00023299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00023299 (402 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB54049.1| hypothetical protein L484_001387 [Morus notabilis] 56 4e-06 >gb|EXB54049.1| hypothetical protein L484_001387 [Morus notabilis] Length = 143 Score = 56.2 bits (134), Expect = 4e-06 Identities = 38/111 (34%), Positives = 59/111 (53%), Gaps = 5/111 (4%) Frame = +2 Query: 77 TFLQHLTPKQQS----KPKVQQFIRREDLNXXXXXXXXXXXXVHFE-SKPLIQNDEISKK 241 TF ++P +++ K + I R++L+ E S+PLI+ + K Sbjct: 7 TFYNRISPDEKALEHRKSNAKSIIYRDELSKTKQAKRKPKKGDSLEFSEPLIEKESGVKT 66 Query: 242 HTDEAENAKEGEVSREKPAVQVKILMTKEEANRLLSKCKKNGGALQFEDVA 394 + AE + G ++VK+ MTKEEANRLLS+C K+GG L+F+DVA Sbjct: 67 VSSRAEEERSG-------VIRVKVTMTKEEANRLLSRC-KDGGVLKFKDVA 109