BLASTX nr result
ID: Mentha26_contig00023266
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00023266 (434 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36066.1| hypothetical protein MIMGU_mgv1a001880mg [Mimulus... 61 2e-07 >gb|EYU36066.1| hypothetical protein MIMGU_mgv1a001880mg [Mimulus guttatus] Length = 745 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 432 QDVEGSGFTSVMGFVSFLDVINQDVLDYINKPNGK 328 QDVEGSGFTSVMGFVSFLD IN DV++Y+ K NGK Sbjct: 711 QDVEGSGFTSVMGFVSFLDEINHDVVEYMTKSNGK 745