BLASTX nr result
ID: Mentha26_contig00023253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00023253 (301 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006449552.1| hypothetical protein CICLE_v10016666mg [Citr... 176 2e-42 ref|XP_006467606.1| PREDICTED: ER lumen protein retaining recept... 175 5e-42 gb|EYU28119.1| hypothetical protein MIMGU_mgv1a013597mg [Mimulus... 174 9e-42 ref|NP_001235015.1| uncharacterized protein LOC100306692 [Glycin... 170 2e-40 ref|XP_007025304.1| ER lumen protein retaining receptor family p... 169 3e-40 ref|XP_002267990.1| PREDICTED: ER lumen protein retaining recept... 169 3e-40 ref|NP_001236222.1| uncharacterized protein LOC100526936 [Glycin... 168 6e-40 ref|XP_002522261.1| er lumen protein retaining receptor, putativ... 168 6e-40 ref|XP_004134621.1| PREDICTED: ER lumen protein retaining recept... 168 8e-40 gb|ADI60302.1| ER luminal protein receptor 2a [Nicotiana bentham... 167 2e-39 ref|XP_004233064.1| PREDICTED: ER lumen protein retaining recept... 166 2e-39 ref|XP_004155536.1| PREDICTED: LOW QUALITY PROTEIN: ER lumen pro... 166 3e-39 ref|XP_007159486.1| hypothetical protein PHAVU_002G241500g [Phas... 165 5e-39 ref|XP_004504277.1| PREDICTED: ER lumen protein retaining recept... 165 5e-39 gb|ADN34026.1| ER lumen protein retaining receptor [Cucumis melo... 165 7e-39 ref|XP_006358100.1| PREDICTED: ER lumen protein retaining recept... 163 2e-38 gb|EPS74562.1| hypothetical protein M569_00193, partial [Genlise... 163 3e-38 ref|NP_564326.1| ER lumen protein retaining receptor [Arabidopsi... 162 6e-38 ref|XP_002893557.1| hypothetical protein ARALYDRAFT_473143 [Arab... 162 6e-38 ref|XP_006415584.1| hypothetical protein EUTSA_v10008757mg [Eutr... 161 8e-38 >ref|XP_006449552.1| hypothetical protein CICLE_v10016666mg [Citrus clementina] gi|557552163|gb|ESR62792.1| hypothetical protein CICLE_v10016666mg [Citrus clementina] Length = 215 Score = 176 bits (447), Expect = 2e-42 Identities = 82/99 (82%), Positives = 94/99 (94%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTDFISVYNTTMKVVFIASSLAIVWYMRFHRAIRRS 182 SCSGISLKTQELYA+VFLTRYLDLFTDFISVYNT MK+VFIASSLAIVW MR HRA+RR+ Sbjct: 28 SCSGISLKTQELYALVFLTRYLDLFTDFISVYNTVMKLVFIASSLAIVWCMRMHRAVRRT 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEIFWAFSI 299 YD++LDTFRHYFL+ ACFLL+L++NEK++ QEIFWAFSI Sbjct: 88 YDKELDTFRHYFLIAACFLLSLILNEKFTFQEIFWAFSI 126 >ref|XP_006467606.1| PREDICTED: ER lumen protein retaining receptor-like [Citrus sinensis] Length = 215 Score = 175 bits (444), Expect = 5e-42 Identities = 81/99 (81%), Positives = 94/99 (94%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTDFISVYNTTMKVVFIASSLAIVWYMRFHRAIRRS 182 SCSGISLKTQELYA+VFLTRYLDLFTDFISVYNT MK+VFIASSLAIVW MR HRA+RR+ Sbjct: 28 SCSGISLKTQELYALVFLTRYLDLFTDFISVYNTVMKLVFIASSLAIVWCMRMHRAVRRT 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEIFWAFSI 299 YD++LDTFRHYFL+ ACF+L+L++NEK++ QEIFWAFSI Sbjct: 88 YDKELDTFRHYFLIAACFVLSLILNEKFTFQEIFWAFSI 126 >gb|EYU28119.1| hypothetical protein MIMGU_mgv1a013597mg [Mimulus guttatus] Length = 215 Score = 174 bits (442), Expect = 9e-42 Identities = 82/99 (82%), Positives = 90/99 (90%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTDFISVYNTTMKVVFIASSLAIVWYMRFHRAIRRS 182 SCSGISLKTQELY IVFL RYLDLFTDFISVYNT MK+VFI SSLAIVW MRFHR ++RS Sbjct: 28 SCSGISLKTQELYGIVFLARYLDLFTDFISVYNTVMKLVFIGSSLAIVWCMRFHRVVKRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEIFWAFSI 299 YDRD+DTFRHYFLVG CFLLAL V+EK+S +E+FWAFSI Sbjct: 88 YDRDVDTFRHYFLVGGCFLLALFVHEKFSFREVFWAFSI 126 >ref|NP_001235015.1| uncharacterized protein LOC100306692 [Glycine max] gi|255629293|gb|ACU14991.1| unknown [Glycine max] Length = 215 Score = 170 bits (431), Expect = 2e-40 Identities = 83/99 (83%), Positives = 91/99 (91%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTDFISVYNTTMKVVFIASSLAIVWYMRFHRAIRRS 182 SCSGIS KTQELYAIVF+ RYLDLFTDFISVYNT MKVVFIASSLAIVW MRFH +RRS Sbjct: 28 SCSGISRKTQELYAIVFVARYLDLFTDFISVYNTFMKVVFIASSLAIVWCMRFHPMVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEIFWAFSI 299 YDR+LDTFRHYFLVGA F LAL+++EK++VQEIFWAFSI Sbjct: 88 YDRELDTFRHYFLVGASFALALILHEKFTVQEIFWAFSI 126 >ref|XP_007025304.1| ER lumen protein retaining receptor family protein [Theobroma cacao] gi|508780670|gb|EOY27926.1| ER lumen protein retaining receptor family protein [Theobroma cacao] Length = 215 Score = 169 bits (429), Expect = 3e-40 Identities = 81/99 (81%), Positives = 92/99 (92%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTDFISVYNTTMKVVFIASSLAIVWYMRFHRAIRRS 182 SCSGISLKTQELYA+VFLTRYLDLFTDFISVYNT MK+VFIASSLAIVW MR HR +RRS Sbjct: 28 SCSGISLKTQELYALVFLTRYLDLFTDFISVYNTIMKLVFIASSLAIVWCMRMHRVVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEIFWAFSI 299 YD+++DTFRHYFL+ A FLLA+LV+EK++ QEIFWAFSI Sbjct: 88 YDKEIDTFRHYFLILASFLLAVLVHEKFTFQEIFWAFSI 126 >ref|XP_002267990.1| PREDICTED: ER lumen protein retaining receptor [Vitis vinifera] gi|297740541|emb|CBI30723.3| unnamed protein product [Vitis vinifera] Length = 215 Score = 169 bits (429), Expect = 3e-40 Identities = 81/99 (81%), Positives = 89/99 (89%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTDFISVYNTTMKVVFIASSLAIVWYMRFHRAIRRS 182 SCSGISLKTQELYA+VFLTRYLDLFTDFISVYNT MK+VFI SSLAIVW MR HR ++RS Sbjct: 28 SCSGISLKTQELYALVFLTRYLDLFTDFISVYNTVMKLVFIGSSLAIVWCMRMHRTVKRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEIFWAFSI 299 YD LDTFRHYFLV ACFL AL+V+EK++ QEIFWAFSI Sbjct: 88 YDGQLDTFRHYFLVAACFLSALIVHEKFTFQEIFWAFSI 126 >ref|NP_001236222.1| uncharacterized protein LOC100526936 [Glycine max] gi|255631185|gb|ACU15958.1| unknown [Glycine max] Length = 215 Score = 168 bits (426), Expect = 6e-40 Identities = 82/99 (82%), Positives = 89/99 (89%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTDFISVYNTTMKVVFIASSLAIVWYMRFHRAIRRS 182 SCSGIS KTQELYAIVF+ RYLDLFTDFISVYNT MKVVFIASSLAI W MRFH +RR Sbjct: 28 SCSGISRKTQELYAIVFVARYLDLFTDFISVYNTFMKVVFIASSLAIFWCMRFHPMVRRG 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEIFWAFSI 299 YDRDLDTFRHYFLVGA F LAL+++EK++VQEIFWAFSI Sbjct: 88 YDRDLDTFRHYFLVGASFALALILHEKFTVQEIFWAFSI 126 >ref|XP_002522261.1| er lumen protein retaining receptor, putative [Ricinus communis] gi|223538514|gb|EEF40119.1| er lumen protein retaining receptor, putative [Ricinus communis] Length = 215 Score = 168 bits (426), Expect = 6e-40 Identities = 80/99 (80%), Positives = 91/99 (91%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTDFISVYNTTMKVVFIASSLAIVWYMRFHRAIRRS 182 SCSGISLKTQELYA+VFLTRYLDLFTDFIS+YN MKVVFIASSLAIVW MR HR ++RS Sbjct: 28 SCSGISLKTQELYALVFLTRYLDLFTDFISLYNYVMKVVFIASSLAIVWCMRRHRVVKRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEIFWAFSI 299 YD++LDTFRHYFLV ACF+LAL V+EK++ +EIFWAFSI Sbjct: 88 YDKELDTFRHYFLVAACFVLALFVHEKFTFREIFWAFSI 126 >ref|XP_004134621.1| PREDICTED: ER lumen protein retaining receptor-like [Cucumis sativus] Length = 215 Score = 168 bits (425), Expect = 8e-40 Identities = 79/99 (79%), Positives = 89/99 (89%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTDFISVYNTTMKVVFIASSLAIVWYMRFHRAIRRS 182 SCSGISLKTQELYA+VFLTRYLDLFTDFIS+YNT MK++FIASSLAIVW MR H +RRS Sbjct: 28 SCSGISLKTQELYALVFLTRYLDLFTDFISIYNTVMKIIFIASSLAIVWCMRVHPIVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEIFWAFSI 299 YD+DLDTFR+YF+V F+LALLVNEK+ QEIFWAFSI Sbjct: 88 YDKDLDTFRYYFIVAGSFILALLVNEKFGFQEIFWAFSI 126 >gb|ADI60302.1| ER luminal protein receptor 2a [Nicotiana benthamiana] Length = 215 Score = 167 bits (422), Expect = 2e-39 Identities = 78/99 (78%), Positives = 91/99 (91%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTDFISVYNTTMKVVFIASSLAIVWYMRFHRAIRRS 182 SCSGISLKTQELYAIVFL RYLDLF+DFIS+YNT MK+VFI SSLAIVW MR+HR +RRS Sbjct: 28 SCSGISLKTQELYAIVFLARYLDLFSDFISLYNTVMKLVFIGSSLAIVWCMRYHRVVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEIFWAFSI 299 YDR+LDTFR++ LVGACF LAL+++EK+S QE+FWAFSI Sbjct: 88 YDRELDTFRYWILVGACFTLALVLHEKFSFQEVFWAFSI 126 >ref|XP_004233064.1| PREDICTED: ER lumen protein retaining receptor-like [Solanum lycopersicum] Length = 215 Score = 166 bits (421), Expect = 2e-39 Identities = 76/99 (76%), Positives = 93/99 (93%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTDFISVYNTTMKVVFIASSLAIVWYMRFHRAIRRS 182 SCSGISLKTQELYAIVF+ RYLDLFTDFIS+YNT MK+VFI SSLAIVW MR+HR +RRS Sbjct: 28 SCSGISLKTQELYAIVFVARYLDLFTDFISLYNTVMKLVFIGSSLAIVWCMRYHRVVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEIFWAFSI 299 YDR+LDTFR++ L+GACF+LAL+++EK+++QE+FWAFSI Sbjct: 88 YDRELDTFRYWILLGACFVLALVLHEKFTLQEVFWAFSI 126 >ref|XP_004155536.1| PREDICTED: LOW QUALITY PROTEIN: ER lumen protein retaining receptor-like [Cucumis sativus] Length = 215 Score = 166 bits (420), Expect = 3e-39 Identities = 78/99 (78%), Positives = 88/99 (88%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTDFISVYNTTMKVVFIASSLAIVWYMRFHRAIRRS 182 SCSGISLKTQELYA+VF TRYLDLFTDFIS+YNT MK++FIASSLAIVW MR H +RRS Sbjct: 28 SCSGISLKTQELYALVFXTRYLDLFTDFISIYNTVMKIIFIASSLAIVWCMRVHPIVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEIFWAFSI 299 YD+DLDTFR+YF+V F+LALLVNEK+ QEIFWAFSI Sbjct: 88 YDKDLDTFRYYFIVAGSFILALLVNEKFGFQEIFWAFSI 126 >ref|XP_007159486.1| hypothetical protein PHAVU_002G241500g [Phaseolus vulgaris] gi|561032901|gb|ESW31480.1| hypothetical protein PHAVU_002G241500g [Phaseolus vulgaris] Length = 215 Score = 165 bits (418), Expect = 5e-39 Identities = 80/99 (80%), Positives = 90/99 (90%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTDFISVYNTTMKVVFIASSLAIVWYMRFHRAIRRS 182 SCSG+S KTQELYAIVF+ RYLDLFTDFISVYNT MKVVFIASSLAIVW MRFH +RRS Sbjct: 28 SCSGVSRKTQELYAIVFIFRYLDLFTDFISVYNTFMKVVFIASSLAIVWCMRFHPVVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEIFWAFSI 299 YDR+LDTFR++FLVGA F LAL+ +EK+SVQE+FWAFSI Sbjct: 88 YDRELDTFRYFFLVGASFALALIWHEKFSVQEVFWAFSI 126 >ref|XP_004504277.1| PREDICTED: ER lumen protein retaining receptor-like [Cicer arietinum] Length = 215 Score = 165 bits (418), Expect = 5e-39 Identities = 79/99 (79%), Positives = 89/99 (89%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTDFISVYNTTMKVVFIASSLAIVWYMRFHRAIRRS 182 SCSG+S KTQELYAIVFL RYLDLFTDFISVYNT MKVVFI SSLAIVW MR H +RRS Sbjct: 28 SCSGVSRKTQELYAIVFLARYLDLFTDFISVYNTFMKVVFIVSSLAIVWCMRVHPLVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEIFWAFSI 299 YD+DLDTFRHYFL+GA F+LAL+++EK++ QEIFWAFSI Sbjct: 88 YDKDLDTFRHYFLIGATFVLALVLHEKFTFQEIFWAFSI 126 >gb|ADN34026.1| ER lumen protein retaining receptor [Cucumis melo subsp. melo] Length = 215 Score = 165 bits (417), Expect = 7e-39 Identities = 79/99 (79%), Positives = 87/99 (87%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTDFISVYNTTMKVVFIASSLAIVWYMRFHRAIRRS 182 SCSGISLKTQELYA+VFLTRYLDLFTDFIS YNT MK++FIASSLAIVW MR H +RRS Sbjct: 28 SCSGISLKTQELYALVFLTRYLDLFTDFISFYNTVMKIIFIASSLAIVWCMRVHPIVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEIFWAFSI 299 YD+DLDTFR+YFLV +LALLVNEK+ QEIFWAFSI Sbjct: 88 YDKDLDTFRYYFLVAGSLILALLVNEKFGFQEIFWAFSI 126 >ref|XP_006358100.1| PREDICTED: ER lumen protein retaining receptor-like [Solanum tuberosum] Length = 215 Score = 163 bits (413), Expect = 2e-38 Identities = 75/99 (75%), Positives = 92/99 (92%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTDFISVYNTTMKVVFIASSLAIVWYMRFHRAIRRS 182 SCSGISLKTQELYAIVF+TRYLDLFTDFIS+YNT MK+VFI SSLAIVW MR+HR +RRS Sbjct: 28 SCSGISLKTQELYAIVFVTRYLDLFTDFISLYNTVMKLVFIGSSLAIVWCMRYHRVVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEIFWAFSI 299 YDR+LDTFR++ L+G F+LAL+++EK+++QE+FWAFSI Sbjct: 88 YDRELDTFRYWILLGVSFILALVLHEKFTLQEVFWAFSI 126 >gb|EPS74562.1| hypothetical protein M569_00193, partial [Genlisea aurea] Length = 153 Score = 163 bits (412), Expect = 3e-38 Identities = 76/97 (78%), Positives = 86/97 (88%) Frame = +3 Query: 9 SGISLKTQELYAIVFLTRYLDLFTDFISVYNTTMKVVFIASSLAIVWYMRFHRAIRRSYD 188 SG+SLKTQELYAIVFL RYLDLFTDFIS+YNT MK++FI SSLAIVW MRFHR +RRSYD Sbjct: 1 SGVSLKTQELYAIVFLARYLDLFTDFISIYNTVMKLIFIGSSLAIVWCMRFHRVVRRSYD 60 Query: 189 RDLDTFRHYFLVGACFLLALLVNEKYSVQEIFWAFSI 299 RDLDTFRHYFLVG LLAL ++EK++ QE+ WAFSI Sbjct: 61 RDLDTFRHYFLVGFSLLLALFIHEKFTFQEVLWAFSI 97 >ref|NP_564326.1| ER lumen protein retaining receptor [Arabidopsis thaliana] gi|544250|sp|P35402.1|ERD2_ARATH RecName: Full=ER lumen protein retaining receptor; AltName: Full=HDEL receptor gi|9502409|gb|AAF88108.1|AC021043_1 endoplasmic reticulum retention receptor Erd2 [Arabidopsis thaliana] gi|12323512|gb|AAG51724.1|AC068667_3 ER lumen protein retaining receptor; 3333-1007 [Arabidopsis thaliana] gi|20260682|gb|AAM13239.1| ER lumen protein retaining receptor; 3333-1007 [Arabidopsis thaliana] gi|32189301|gb|AAP75805.1| At1g29330 [Arabidopsis thaliana] gi|332192952|gb|AEE31073.1| ER lumen protein retaining receptor [Arabidopsis thaliana] Length = 215 Score = 162 bits (409), Expect = 6e-38 Identities = 74/99 (74%), Positives = 91/99 (91%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTDFISVYNTTMKVVFIASSLAIVWYMRFHRAIRRS 182 SC+GISLKTQELYA+VFLTRYLDLFTD++S+YN+ MK+VFIASSLAIVW MR H +RRS Sbjct: 28 SCAGISLKTQELYALVFLTRYLDLFTDYVSLYNSIMKIVFIASSLAIVWCMRRHPLVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEIFWAFSI 299 YD+DLDTFRH ++V ACF+L L++NEK++VQE+FWAFSI Sbjct: 88 YDKDLDTFRHQYVVLACFVLGLILNEKFTVQEVFWAFSI 126 >ref|XP_002893557.1| hypothetical protein ARALYDRAFT_473143 [Arabidopsis lyrata subsp. lyrata] gi|297339399|gb|EFH69816.1| hypothetical protein ARALYDRAFT_473143 [Arabidopsis lyrata subsp. lyrata] Length = 215 Score = 162 bits (409), Expect = 6e-38 Identities = 74/99 (74%), Positives = 91/99 (91%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTDFISVYNTTMKVVFIASSLAIVWYMRFHRAIRRS 182 SC+GISLKTQELYA+VFLTRYLDLFTD++S+YN+ MK+VFIASSLAIVW MR H +RRS Sbjct: 28 SCAGISLKTQELYALVFLTRYLDLFTDYVSLYNSVMKIVFIASSLAIVWCMRRHPLVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEIFWAFSI 299 YD+DLDTFRH ++V ACF+LAL++NEK++ QE+FWAFSI Sbjct: 88 YDKDLDTFRHQYVVLACFVLALILNEKFTFQEVFWAFSI 126 >ref|XP_006415584.1| hypothetical protein EUTSA_v10008757mg [Eutrema salsugineum] gi|557093355|gb|ESQ33937.1| hypothetical protein EUTSA_v10008757mg [Eutrema salsugineum] Length = 215 Score = 161 bits (408), Expect = 8e-38 Identities = 73/99 (73%), Positives = 92/99 (92%) Frame = +3 Query: 3 SCSGISLKTQELYAIVFLTRYLDLFTDFISVYNTTMKVVFIASSLAIVWYMRFHRAIRRS 182 SC+GISLKTQELYA+VFLTRYLDLFTD++S+YN+ MK+VFIASSLAIVW MR H +RRS Sbjct: 28 SCAGISLKTQELYALVFLTRYLDLFTDYVSLYNSVMKIVFIASSLAIVWCMRRHPLVRRS 87 Query: 183 YDRDLDTFRHYFLVGACFLLALLVNEKYSVQEIFWAFSI 299 YD+DLDTFRH F+V ACF+LAL+++E++++QE+FWAFSI Sbjct: 88 YDKDLDTFRHQFVVLACFVLALILHERFTIQEVFWAFSI 126