BLASTX nr result
ID: Mentha26_contig00022992
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00022992 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006369739.1| hypothetical protein POPTR_0001s30420g [Popu... 84 2e-14 gb|EYU37594.1| hypothetical protein MIMGU_mgv1a009172mg [Mimulus... 81 2e-13 gb|EPS70895.1| hypothetical protein M569_03868, partial [Genlise... 81 2e-13 ref|XP_002527484.1| conserved hypothetical protein [Ricinus comm... 75 1e-11 ref|XP_006486949.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-... 74 2e-11 ref|XP_006346327.1| PREDICTED: uncharacterized protein LOC102592... 74 2e-11 ref|XP_006422860.1| hypothetical protein CICLE_v10028999mg [Citr... 74 2e-11 ref|NP_001237884.1| RING-H2 finger protein [Glycine max] gi|2259... 74 3e-11 ref|XP_007143093.1| hypothetical protein PHAVU_007G042900g [Phas... 73 4e-11 ref|XP_007042594.1| RING/U-box superfamily protein, putative iso... 72 8e-11 ref|XP_007042593.1| RING/U-box superfamily protein, putative iso... 72 8e-11 ref|XP_007042592.1| RING/U-box superfamily protein, putative iso... 72 8e-11 ref|XP_007042591.1| RING/U-box superfamily protein, putative iso... 72 8e-11 ref|XP_004230712.1| PREDICTED: uncharacterized protein LOC101244... 72 1e-10 ref|XP_004496896.1| PREDICTED: E3 ubiquitin-protein ligase SDIR1... 69 7e-10 ref|XP_002886587.1| hypothetical protein ARALYDRAFT_475251 [Arab... 69 7e-10 ref|XP_006393209.1| hypothetical protein EUTSA_v10011738mg [Eutr... 68 1e-09 ref|XP_002894222.1| ring-H2 finger protein RHY1a [Arabidopsis ly... 68 1e-09 ref|XP_006305474.1| hypothetical protein CARUB_v10009905mg, part... 67 2e-09 ref|XP_007201885.1| hypothetical protein PRUPE_ppa009751mg [Prun... 67 3e-09 >ref|XP_006369739.1| hypothetical protein POPTR_0001s30420g [Populus trichocarpa] gi|550348547|gb|ERP66308.1| hypothetical protein POPTR_0001s30420g [Populus trichocarpa] Length = 283 Score = 84.0 bits (206), Expect = 2e-14 Identities = 35/44 (79%), Positives = 36/44 (81%) Frame = -3 Query: 313 ESFSVGDELIRLPCDHRYHFCCLYPWVRTCGDCPYCRRGIDAKN 182 ESFS GDELIRLPCDHR+H CL PWVRTCGDCPYCRR I N Sbjct: 239 ESFSEGDELIRLPCDHRFHSACLDPWVRTCGDCPYCRRDIVVSN 282 >gb|EYU37594.1| hypothetical protein MIMGU_mgv1a009172mg [Mimulus guttatus] Length = 350 Score = 80.9 bits (198), Expect = 2e-13 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -3 Query: 313 ESFSVGDELIRLPCDHRYHFCCLYPWVRTCGDCPYCRRGIDA 188 ESFS G++L LPC HRYHFCCL PWVRTCGDCPYCRR I A Sbjct: 306 ESFSEGEKLTCLPCGHRYHFCCLGPWVRTCGDCPYCRRSIYA 347 >gb|EPS70895.1| hypothetical protein M569_03868, partial [Genlisea aurea] Length = 83 Score = 80.9 bits (198), Expect = 2e-13 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -3 Query: 313 ESFSVGDELIRLPCDHRYHFCCLYPWVRTCGDCPYCRRGID 191 ESFS+GDEL+RL C H YH CCLYPW++TCGDCPYCR+ I+ Sbjct: 41 ESFSIGDELVRLHCGHGYHICCLYPWLQTCGDCPYCRQRIN 81 >ref|XP_002527484.1| conserved hypothetical protein [Ricinus communis] gi|223533124|gb|EEF34882.1| conserved hypothetical protein [Ricinus communis] Length = 282 Score = 74.7 bits (182), Expect = 1e-11 Identities = 31/47 (65%), Positives = 35/47 (74%) Frame = -3 Query: 313 ESFSVGDELIRLPCDHRYHFCCLYPWVRTCGDCPYCRRGIDAKNSES 173 ESF GD+LI LPC+HR+H CL PWVRTCGDCPYCRR I + S Sbjct: 236 ESFKDGDKLICLPCNHRFHSSCLDPWVRTCGDCPYCRRDIAVSSRSS 282 >ref|XP_006486949.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like [Citrus sinensis] Length = 283 Score = 74.3 bits (181), Expect = 2e-11 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = -3 Query: 313 ESFSVGDELIRLPCDHRYHFCCLYPWVRTCGDCPYCRRGIDAKNSES 173 ESF+ GDELI LPC HR+H CL PWVR+CGDCPYCRR I + +S Sbjct: 236 ESFTDGDELICLPCKHRFHSDCLDPWVRSCGDCPYCRRNIVVNSDKS 282 >ref|XP_006346327.1| PREDICTED: uncharacterized protein LOC102592559 isoform X1 [Solanum tuberosum] gi|565359035|ref|XP_006346328.1| PREDICTED: uncharacterized protein LOC102592559 isoform X2 [Solanum tuberosum] Length = 288 Score = 74.3 bits (181), Expect = 2e-11 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 313 ESFSVGDELIRLPCDHRYHFCCLYPWVRTCGDCPYCRRGIDA 188 ++F GD+L+ LPC HRYH CCL PWVRTCGDCPYCR I A Sbjct: 234 DAFLEGDKLVCLPCGHRYHPCCLEPWVRTCGDCPYCRAAIHA 275 >ref|XP_006422860.1| hypothetical protein CICLE_v10028999mg [Citrus clementina] gi|557524794|gb|ESR36100.1| hypothetical protein CICLE_v10028999mg [Citrus clementina] Length = 283 Score = 74.3 bits (181), Expect = 2e-11 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = -3 Query: 313 ESFSVGDELIRLPCDHRYHFCCLYPWVRTCGDCPYCRRGIDAKNSES 173 ESF+ GDELI LPC HR+H CL PWVR+CGDCPYCRR I + +S Sbjct: 236 ESFTDGDELICLPCKHRFHSDCLDPWVRSCGDCPYCRRNIVVNSDKS 282 >ref|NP_001237884.1| RING-H2 finger protein [Glycine max] gi|22597166|gb|AAN03470.1| RING-H2 finger protein [Glycine max] Length = 246 Score = 73.6 bits (179), Expect = 3e-11 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -3 Query: 313 ESFSVGDELIRLPCDHRYHFCCLYPWVRTCGDCPYCRRGI 194 ESF+ GDELIRLPC H++H CL PW+R CGDCPYCRR I Sbjct: 195 ESFTDGDELIRLPCGHKFHSVCLDPWIRCCGDCPYCRRCI 234 >ref|XP_007143093.1| hypothetical protein PHAVU_007G042900g [Phaseolus vulgaris] gi|561016283|gb|ESW15087.1| hypothetical protein PHAVU_007G042900g [Phaseolus vulgaris] Length = 237 Score = 73.2 bits (178), Expect = 4e-11 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -3 Query: 313 ESFSVGDELIRLPCDHRYHFCCLYPWVRTCGDCPYCRRGI 194 E+F+ GDELIRLPC H++H CL PW+R+CGDCPYCRR + Sbjct: 191 ETFTDGDELIRLPCGHKFHSVCLDPWIRSCGDCPYCRRRV 230 >ref|XP_007042594.1| RING/U-box superfamily protein, putative isoform 4 [Theobroma cacao] gi|508706529|gb|EOX98425.1| RING/U-box superfamily protein, putative isoform 4 [Theobroma cacao] Length = 203 Score = 72.0 bits (175), Expect = 8e-11 Identities = 29/40 (72%), Positives = 30/40 (75%) Frame = -3 Query: 313 ESFSVGDELIRLPCDHRYHFCCLYPWVRTCGDCPYCRRGI 194 ESF D L RLPC HR+H CL PWVRTCGDCPYCRR I Sbjct: 161 ESFGDDDVLTRLPCGHRFHLACLDPWVRTCGDCPYCRRSI 200 >ref|XP_007042593.1| RING/U-box superfamily protein, putative isoform 3 [Theobroma cacao] gi|508706528|gb|EOX98424.1| RING/U-box superfamily protein, putative isoform 3 [Theobroma cacao] Length = 256 Score = 72.0 bits (175), Expect = 8e-11 Identities = 29/40 (72%), Positives = 30/40 (75%) Frame = -3 Query: 313 ESFSVGDELIRLPCDHRYHFCCLYPWVRTCGDCPYCRRGI 194 ESF D L RLPC HR+H CL PWVRTCGDCPYCRR I Sbjct: 214 ESFGDDDVLTRLPCGHRFHLACLDPWVRTCGDCPYCRRSI 253 >ref|XP_007042592.1| RING/U-box superfamily protein, putative isoform 2 [Theobroma cacao] gi|508706527|gb|EOX98423.1| RING/U-box superfamily protein, putative isoform 2 [Theobroma cacao] Length = 257 Score = 72.0 bits (175), Expect = 8e-11 Identities = 29/40 (72%), Positives = 30/40 (75%) Frame = -3 Query: 313 ESFSVGDELIRLPCDHRYHFCCLYPWVRTCGDCPYCRRGI 194 ESF D L RLPC HR+H CL PWVRTCGDCPYCRR I Sbjct: 215 ESFGDDDVLTRLPCGHRFHLACLDPWVRTCGDCPYCRRSI 254 >ref|XP_007042591.1| RING/U-box superfamily protein, putative isoform 1 [Theobroma cacao] gi|508706526|gb|EOX98422.1| RING/U-box superfamily protein, putative isoform 1 [Theobroma cacao] Length = 277 Score = 72.0 bits (175), Expect = 8e-11 Identities = 29/40 (72%), Positives = 30/40 (75%) Frame = -3 Query: 313 ESFSVGDELIRLPCDHRYHFCCLYPWVRTCGDCPYCRRGI 194 ESF D L RLPC HR+H CL PWVRTCGDCPYCRR I Sbjct: 235 ESFGDDDVLTRLPCGHRFHLACLDPWVRTCGDCPYCRRSI 274 >ref|XP_004230712.1| PREDICTED: uncharacterized protein LOC101244425, partial [Solanum lycopersicum] Length = 278 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -3 Query: 313 ESFSVGDELIRLPCDHRYHFCCLYPWVRTCGDCPYCRRGI 194 ++F GD+L LPC HRYH CCL PWVRTCGDCPYCR I Sbjct: 237 DAFLEGDKLACLPCGHRYHPCCLEPWVRTCGDCPYCRAAI 276 >ref|XP_004496896.1| PREDICTED: E3 ubiquitin-protein ligase SDIR1-like [Cicer arietinum] Length = 255 Score = 68.9 bits (167), Expect = 7e-10 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = -3 Query: 313 ESFSVGDELIRLPCDHRYHFCCLYPWVRTCGDCPYCRRGI 194 ESF GDELI L C H++H CL PW+R+CGDCPYCRR I Sbjct: 204 ESFRDGDELIHLQCGHKFHSACLDPWIRSCGDCPYCRRCI 243 >ref|XP_002886587.1| hypothetical protein ARALYDRAFT_475251 [Arabidopsis lyrata subsp. lyrata] gi|297332428|gb|EFH62846.1| hypothetical protein ARALYDRAFT_475251 [Arabidopsis lyrata subsp. lyrata] Length = 238 Score = 68.9 bits (167), Expect = 7e-10 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = -3 Query: 313 ESFSVGDELIRLPCDHRYHFCCLYPWVRTCGDCPYCRRGI 194 ESF+ GD LI LPC H +H CL PW+R CGDCPYCRR I Sbjct: 196 ESFTKGDMLISLPCTHSFHSSCLNPWLRACGDCPYCRRAI 235 >ref|XP_006393209.1| hypothetical protein EUTSA_v10011738mg [Eutrema salsugineum] gi|557089787|gb|ESQ30495.1| hypothetical protein EUTSA_v10011738mg [Eutrema salsugineum] Length = 247 Score = 67.8 bits (164), Expect = 1e-09 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = -3 Query: 313 ESFSVGDELIRLPCDHRYHFCCLYPWVRTCGDCPYCRRGI 194 ESF+ GD LI LPC H +H CL PW++ CGDCPYCRR I Sbjct: 206 ESFAKGDILISLPCSHSFHSSCLNPWLKACGDCPYCRRAI 245 >ref|XP_002894222.1| ring-H2 finger protein RHY1a [Arabidopsis lyrata subsp. lyrata] gi|297340064|gb|EFH70481.1| ring-H2 finger protein RHY1a [Arabidopsis lyrata subsp. lyrata] Length = 248 Score = 67.8 bits (164), Expect = 1e-09 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = -3 Query: 313 ESFSVGDELIRLPCDHRYHFCCLYPWVRTCGDCPYCRRGI 194 ESF+ GD LI LPC H +H CL PW++ CGDCPYCRR I Sbjct: 206 ESFTKGDMLISLPCTHSFHSSCLNPWLKACGDCPYCRRAI 245 >ref|XP_006305474.1| hypothetical protein CARUB_v10009905mg, partial [Capsella rubella] gi|482574185|gb|EOA38372.1| hypothetical protein CARUB_v10009905mg, partial [Capsella rubella] Length = 291 Score = 67.4 bits (163), Expect = 2e-09 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = -3 Query: 313 ESFSVGDELIRLPCDHRYHFCCLYPWVRTCGDCPYCRRGI 194 ESF+ D+LI LPC H +H CL PW+R CGDCPYCRR I Sbjct: 249 ESFTKDDKLISLPCTHSFHSSCLNPWLRACGDCPYCRRAI 288 >ref|XP_007201885.1| hypothetical protein PRUPE_ppa009751mg [Prunus persica] gi|462397285|gb|EMJ03084.1| hypothetical protein PRUPE_ppa009751mg [Prunus persica] Length = 279 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/40 (72%), Positives = 30/40 (75%) Frame = -3 Query: 313 ESFSVGDELIRLPCDHRYHFCCLYPWVRTCGDCPYCRRGI 194 ESF GDELI LPC HR+H CL PWVR GDCPYCRR I Sbjct: 229 ESFLDGDELINLPCAHRFHAVCLGPWVRIRGDCPYCRRVI 268