BLASTX nr result
ID: Mentha26_contig00022957
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00022957 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24788.1| hypothetical protein MIMGU_mgv1a007856mg [Mimulus... 64 2e-08 >gb|EYU24788.1| hypothetical protein MIMGU_mgv1a007856mg [Mimulus guttatus] Length = 393 Score = 63.9 bits (154), Expect = 2e-08 Identities = 49/102 (48%), Positives = 62/102 (60%), Gaps = 8/102 (7%) Frame = -2 Query: 283 MSFAANQSYATLSQILVN---KSL-LLPKPQSLQTLYLTKRNVHLD--KPLHISAAAGFG 122 M+F+ANQ+YAT + N K++ L KP + TL K+N L KPL+IS+A GFG Sbjct: 1 MAFSANQTYATGPKFAENFPKKTISTLLKPHNFPTLNPCKKNYLLPQHKPLYISSATGFG 60 Query: 121 CSAPGPEGPPPARCGAYEA-RSQP-APISIEFDGDGAAQKAR 2 + P RC AYEA RSQP PISI FD + AAQKA+ Sbjct: 61 PART--RDPFSMRCNAYEAGRSQPVVPISIGFDREEAAQKAK 100