BLASTX nr result
ID: Mentha26_contig00022574
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00022574 (543 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007021317.1| Peroxisomal membrane 22 kDa family protein i... 76 6e-12 ref|XP_007021315.1| Peroxisomal membrane 22 kDa family protein i... 76 6e-12 gb|EYU26408.1| hypothetical protein MIMGU_mgv1a007901mg [Mimulus... 75 8e-12 emb|CBI20352.3| unnamed protein product [Vitis vinifera] 71 1e-10 ref|XP_002284644.1| PREDICTED: uncharacterized protein LOC100253... 71 1e-10 ref|XP_006464706.1| PREDICTED: uncharacterized protein LOC102611... 70 3e-10 ref|XP_006451944.1| hypothetical protein CICLE_v10008646mg [Citr... 70 3e-10 ref|XP_006451942.1| hypothetical protein CICLE_v10008646mg [Citr... 70 3e-10 ref|XP_004291669.1| PREDICTED: uncharacterized protein LOC101306... 70 3e-10 gb|EXB50359.1| Peroxisomal membrane protein 2 [Morus notabilis] 69 1e-09 ref|XP_007211442.1| hypothetical protein PRUPE_ppa007209mg [Prun... 69 1e-09 ref|XP_006370309.1| hypothetical protein POPTR_0001s41510g [Popu... 69 1e-09 ref|XP_002530181.1| conserved hypothetical protein [Ricinus comm... 68 1e-09 ref|XP_003543349.1| PREDICTED: peroxisomal membrane protein 2 [G... 67 3e-09 ref|XP_003539526.1| PREDICTED: peroxisomal membrane protein 2-li... 67 3e-09 gb|EYU26133.1| hypothetical protein MIMGU_mgv1a009627mg [Mimulus... 67 4e-09 ref|XP_002317517.2| hypothetical protein POPTR_0011s12440g [Popu... 66 6e-09 ref|XP_004149288.1| PREDICTED: uncharacterized protein LOC101205... 65 1e-08 ref|XP_007149878.1| hypothetical protein PHAVU_005G106400g [Phas... 65 1e-08 ref|NP_564615.3| peroxisomal membrane Mpv17/PMP22 family protein... 64 2e-08 >ref|XP_007021317.1| Peroxisomal membrane 22 kDa family protein isoform 3 [Theobroma cacao] gi|508720945|gb|EOY12842.1| Peroxisomal membrane 22 kDa family protein isoform 3 [Theobroma cacao] Length = 391 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 541 LLWVDCVELIWVTILSTYSNEKSEARISEAPAEDIASLPP 422 LLWVDCVELIWVTILSTYSNEKSEARI+EAPAE +SLPP Sbjct: 342 LLWVDCVELIWVTILSTYSNEKSEARIAEAPAEANSSLPP 381 >ref|XP_007021315.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma cacao] gi|590608627|ref|XP_007021316.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma cacao] gi|508720943|gb|EOY12840.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma cacao] gi|508720944|gb|EOY12841.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma cacao] Length = 386 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 541 LLWVDCVELIWVTILSTYSNEKSEARISEAPAEDIASLPP 422 LLWVDCVELIWVTILSTYSNEKSEARI+EAPAE +SLPP Sbjct: 337 LLWVDCVELIWVTILSTYSNEKSEARIAEAPAEANSSLPP 376 >gb|EYU26408.1| hypothetical protein MIMGU_mgv1a007901mg [Mimulus guttatus] Length = 392 Score = 75.5 bits (184), Expect = 8e-12 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -3 Query: 541 LLWVDCVELIWVTILSTYSNEKSEARISEAPAEDIASLPP 422 LLWVDCVELIWVTILSTYSNEKSEARI+EAP E ASLPP Sbjct: 346 LLWVDCVELIWVTILSTYSNEKSEARITEAPVEANASLPP 385 >emb|CBI20352.3| unnamed protein product [Vitis vinifera] Length = 262 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -3 Query: 541 LLWVDCVELIWVTILSTYSNEKSEARISEAPAEDIASLPPS 419 LLWVDCVELIWVTILSTYSNEKSEAR+SEA AE ++ PP+ Sbjct: 217 LLWVDCVELIWVTILSTYSNEKSEARVSEASAEAASNSPPT 257 >ref|XP_002284644.1| PREDICTED: uncharacterized protein LOC100253839 [Vitis vinifera] Length = 371 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -3 Query: 541 LLWVDCVELIWVTILSTYSNEKSEARISEAPAEDIASLPPS 419 LLWVDCVELIWVTILSTYSNEKSEAR+SEA AE ++ PP+ Sbjct: 326 LLWVDCVELIWVTILSTYSNEKSEARVSEASAEAASNSPPT 366 >ref|XP_006464706.1| PREDICTED: uncharacterized protein LOC102611604 [Citrus sinensis] Length = 365 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = -3 Query: 541 LLWVDCVELIWVTILSTYSNEKSEARISEAPAEDIASLP 425 LLWVDCVELIWVTILSTYSNEKSEARI+EAPAE LP Sbjct: 320 LLWVDCVELIWVTILSTYSNEKSEARIAEAPAEVKPCLP 358 >ref|XP_006451944.1| hypothetical protein CICLE_v10008646mg [Citrus clementina] gi|557555170|gb|ESR65184.1| hypothetical protein CICLE_v10008646mg [Citrus clementina] Length = 380 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = -3 Query: 541 LLWVDCVELIWVTILSTYSNEKSEARISEAPAEDIASLP 425 LLWVDCVELIWVTILSTYSNEKSEARI+EAPAE LP Sbjct: 323 LLWVDCVELIWVTILSTYSNEKSEARIAEAPAEVKPCLP 361 >ref|XP_006451942.1| hypothetical protein CICLE_v10008646mg [Citrus clementina] gi|567919874|ref|XP_006451943.1| hypothetical protein CICLE_v10008646mg [Citrus clementina] gi|567919880|ref|XP_006451946.1| hypothetical protein CICLE_v10008646mg [Citrus clementina] gi|557555168|gb|ESR65182.1| hypothetical protein CICLE_v10008646mg [Citrus clementina] gi|557555169|gb|ESR65183.1| hypothetical protein CICLE_v10008646mg [Citrus clementina] gi|557555172|gb|ESR65186.1| hypothetical protein CICLE_v10008646mg [Citrus clementina] Length = 368 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = -3 Query: 541 LLWVDCVELIWVTILSTYSNEKSEARISEAPAEDIASLP 425 LLWVDCVELIWVTILSTYSNEKSEARI+EAPAE LP Sbjct: 323 LLWVDCVELIWVTILSTYSNEKSEARIAEAPAEVKPCLP 361 >ref|XP_004291669.1| PREDICTED: uncharacterized protein LOC101306984 [Fragaria vesca subsp. vesca] Length = 377 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -3 Query: 541 LLWVDCVELIWVTILSTYSNEKSEARISEAPAEDIASLP 425 LLWVDCVELIWVTILSTYSNEKSEARIS+APAE ++ P Sbjct: 332 LLWVDCVELIWVTILSTYSNEKSEARISDAPAEASSNSP 370 >gb|EXB50359.1| Peroxisomal membrane protein 2 [Morus notabilis] Length = 393 Score = 68.6 bits (166), Expect = 1e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 541 LLWVDCVELIWVTILSTYSNEKSEARISEAPAE 443 LLWVDCVELIWVTILSTYSNEKSEARISEAP E Sbjct: 329 LLWVDCVELIWVTILSTYSNEKSEARISEAPVE 361 >ref|XP_007211442.1| hypothetical protein PRUPE_ppa007209mg [Prunus persica] gi|462407307|gb|EMJ12641.1| hypothetical protein PRUPE_ppa007209mg [Prunus persica] Length = 378 Score = 68.6 bits (166), Expect = 1e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 541 LLWVDCVELIWVTILSTYSNEKSEARISEAPAE 443 LLWVDCVELIWVTILSTYSNEKSEARISEAP E Sbjct: 333 LLWVDCVELIWVTILSTYSNEKSEARISEAPVE 365 >ref|XP_006370309.1| hypothetical protein POPTR_0001s41510g [Populus trichocarpa] gi|118488904|gb|ABK96261.1| unknown [Populus trichocarpa x Populus deltoides] gi|550349488|gb|ERP66878.1| hypothetical protein POPTR_0001s41510g [Populus trichocarpa] Length = 369 Score = 68.6 bits (166), Expect = 1e-09 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -3 Query: 541 LLWVDCVELIWVTILSTYSNEKSEARISEAPAEDIASLPPSN 416 LLWVDCVELIWVTILSTYSNEKSEARISEA E +S PS+ Sbjct: 325 LLWVDCVELIWVTILSTYSNEKSEARISEAAVEASSSSLPSS 366 >ref|XP_002530181.1| conserved hypothetical protein [Ricinus communis] gi|223530300|gb|EEF32195.1| conserved hypothetical protein [Ricinus communis] Length = 306 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 541 LLWVDCVELIWVTILSTYSNEKSEARISEAPAEDIAS 431 LLWVDCVELIWVTILSTYSNEKSEARI+E PAE +S Sbjct: 191 LLWVDCVELIWVTILSTYSNEKSEARIAETPAEATSS 227 >ref|XP_003543349.1| PREDICTED: peroxisomal membrane protein 2 [Glycine max] Length = 322 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -3 Query: 541 LLWVDCVELIWVTILSTYSNEKSEARISEAPAEDIASLPPSN 416 LLWVDCVELIWVTILSTYSNEKSEARISEA +E +S N Sbjct: 278 LLWVDCVELIWVTILSTYSNEKSEARISEAASETGSSTSSEN 319 >ref|XP_003539526.1| PREDICTED: peroxisomal membrane protein 2-like [Glycine max] Length = 322 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -3 Query: 541 LLWVDCVELIWVTILSTYSNEKSEARISEAPAEDIASLPPSN 416 LLWVDCVELIWVTILSTYSNEKSEARISEA +E +S N Sbjct: 278 LLWVDCVELIWVTILSTYSNEKSEARISEAASETGSSTSSEN 319 >gb|EYU26133.1| hypothetical protein MIMGU_mgv1a009627mg [Mimulus guttatus] Length = 336 Score = 66.6 bits (161), Expect = 4e-09 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -3 Query: 541 LLWVDCVELIWVTILSTYSNEKSEARISEAPAEDIASLPPSN 416 LLWVDC+ELIWVTILSTYSNEKSE RISEAP + S PSN Sbjct: 291 LLWVDCIELIWVTILSTYSNEKSEVRISEAPEGESGS--PSN 330 >ref|XP_002317517.2| hypothetical protein POPTR_0011s12440g [Populus trichocarpa] gi|550328227|gb|EEE98129.2| hypothetical protein POPTR_0011s12440g [Populus trichocarpa] Length = 370 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -3 Query: 541 LLWVDCVELIWVTILSTYSNEKSEARISEAPAEDIAS 431 LLWVDCVELIWVTILSTYSNEKSEARISEA E +S Sbjct: 325 LLWVDCVELIWVTILSTYSNEKSEARISEATVEASSS 361 >ref|XP_004149288.1| PREDICTED: uncharacterized protein LOC101205134 [Cucumis sativus] gi|449528619|ref|XP_004171301.1| PREDICTED: uncharacterized protein LOC101228605 [Cucumis sativus] Length = 376 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -3 Query: 541 LLWVDCVELIWVTILSTYSNEKSEARISEAPAEDIASLP 425 LLWVDCVELIWVTILSTYSNEKSEARISE A D++S P Sbjct: 331 LLWVDCVELIWVTILSTYSNEKSEARISEV-ATDLSSDP 368 >ref|XP_007149878.1| hypothetical protein PHAVU_005G106400g [Phaseolus vulgaris] gi|561023142|gb|ESW21872.1| hypothetical protein PHAVU_005G106400g [Phaseolus vulgaris] Length = 316 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -3 Query: 541 LLWVDCVELIWVTILSTYSNEKSEARISEAPAEDIASLPPSN 416 LLWVDCVEL+WVTILSTYSNEKSE RISE+ +E +S N Sbjct: 272 LLWVDCVELVWVTILSTYSNEKSETRISESASETTSSTSNQN 313 >ref|NP_564615.3| peroxisomal membrane Mpv17/PMP22 family protein [Arabidopsis thaliana] gi|12324641|gb|AAG52277.1|AC019018_14 unknown protein; 54928-56750 [Arabidopsis thaliana] gi|14326545|gb|AAK60317.1|AF385726_1 At1g52870/F14G24_14 [Arabidopsis thaliana] gi|25090145|gb|AAN72239.1| At1g52870/F14G24_14 [Arabidopsis thaliana] gi|332194741|gb|AEE32862.1| peroxisomal membrane Mpv17/PMP22 family protein [Arabidopsis thaliana] Length = 366 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 541 LLWVDCVELIWVTILSTYSNEKSEARISEAPAEDIAS 431 LLWVDCVELIWVTILSTYSNEKSEARISE+ E +S Sbjct: 320 LLWVDCVELIWVTILSTYSNEKSEARISESVIETSSS 356