BLASTX nr result
ID: Mentha26_contig00022480
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00022480 (446 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36476.1| hypothetical protein MIMGU_mgv1a011581mg [Mimulus... 60 3e-07 >gb|EYU36476.1| hypothetical protein MIMGU_mgv1a011581mg [Mimulus guttatus] Length = 277 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/60 (50%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = -2 Query: 178 TRPRNSNHHLFLVKNNPPLRALPT-IQSESAQESSPELEEEVSKTRLLVQNVPWTSTEED 2 T+ R +N LF+V++ P + A+P +QSE+ +E+ E E+EVS+TRLL+QNVPWT T +D Sbjct: 42 TKRRRANLQLFIVQSTPQVEAIPAAVQSEAPEENVAE-EDEVSQTRLLLQNVPWTCTADD 100