BLASTX nr result
ID: Mentha26_contig00022364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00022364 (377 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAE06272.1| cyclin D [Scutellaria baicalensis] 59 7e-07 >dbj|BAE06272.1| cyclin D [Scutellaria baicalensis] Length = 372 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 2 DSWAVALSASSSPEPLFKKIRAQDQHMRLAPLSGM 106 DSWAV LS SSSPEP FK+ +AQDQHMRLAPLS + Sbjct: 329 DSWAVTLSVSSSPEPSFKRSKAQDQHMRLAPLSSV 363