BLASTX nr result
ID: Mentha26_contig00022146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00022146 (342 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007041475.1| Major facilitator superfamily protein isofor... 56 6e-06 >ref|XP_007041475.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao] gi|508705410|gb|EOX97306.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao] Length = 542 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/64 (51%), Positives = 41/64 (64%), Gaps = 4/64 (6%) Frame = -2 Query: 341 AAGIWFIGIFMPSVDRYNEDD--SVPVVDKSNSTPLLAEKTETA*FS--GQLWMPCSAQQ 174 AAGIWFIG F+ SVDR+NED V VD+SN+TPLL K A S G L + CS + Sbjct: 460 AAGIWFIGTFLHSVDRFNEDSEGQVTEVDRSNTTPLLGPKVAEARESSDGVLRLECSERL 519 Query: 173 RRLL 162 + L+ Sbjct: 520 QHLV 523