BLASTX nr result
ID: Mentha26_contig00021934
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00021934 (433 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19020.1| hypothetical protein MIMGU_mgv1a009873mg [Mimulus... 60 4e-07 ref|XP_004508583.1| PREDICTED: uncharacterized protein LOC101509... 59 9e-07 ref|NP_565079.1| cyclophilin-like peptidyl-prolyl cis-trans isom... 59 9e-07 ref|XP_002888963.1| peptidyl-prolyl cis-trans isomerase cyclophi... 59 9e-07 ref|XP_002511993.1| peptidyl-prolyl cis-trans isomerase B, ppib,... 59 9e-07 gb|AAL32738.1| Unknown protein [Arabidopsis thaliana] gi|2025995... 59 9e-07 ref|XP_006600789.1| PREDICTED: uncharacterized protein LOC100796... 58 1e-06 ref|XP_007155161.1| hypothetical protein PHAVU_003G178500g [Phas... 58 1e-06 ref|XP_004967980.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 58 1e-06 ref|XP_003525643.1| PREDICTED: uncharacterized protein LOC100800... 58 1e-06 ref|XP_003609079.1| Peptidyl-prolyl cis-trans isomerase [Medicag... 58 1e-06 ref|XP_002318560.1| peptidyl-prolyl cis-trans isomerase cyclophi... 58 1e-06 gb|ACJ83585.1| unknown [Medicago truncatula] gi|388522903|gb|AFK... 58 1e-06 ref|XP_004157426.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 58 2e-06 ref|XP_004137461.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 58 2e-06 gb|EXC28048.1| Peptidyl-prolyl cis-trans isomerase CYP20-1 [Moru... 57 2e-06 ref|XP_006494257.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 57 2e-06 ref|XP_006440898.1| hypothetical protein CICLE_v10021171mg [Citr... 57 2e-06 ref|XP_006390469.1| hypothetical protein EUTSA_v10018882mg [Eutr... 57 2e-06 gb|EPS65914.1| hypothetical protein M569_08864, partial [Genlise... 57 2e-06 >gb|EYU19020.1| hypothetical protein MIMGU_mgv1a009873mg [Mimulus guttatus] Length = 307 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 431 KLIGDKRAVVAERGFNRPYSKVVVTNSGLI 342 KLIGDKRAVVAERGFNRPYSKVVVTN GLI Sbjct: 277 KLIGDKRAVVAERGFNRPYSKVVVTNCGLI 306 >ref|XP_004508583.1| PREDICTED: uncharacterized protein LOC101509777 [Cicer arietinum] Length = 324 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 431 KLIGDKRAVVAERGFNRPYSKVVVTNSGLI 342 KLIGDKRAVVAERGFNRPYSKVVVTN G+I Sbjct: 294 KLIGDKRAVVAERGFNRPYSKVVVTNCGVI 323 >ref|NP_565079.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein [Arabidopsis thaliana] gi|332197424|gb|AEE35545.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein [Arabidopsis thaliana] Length = 317 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 431 KLIGDKRAVVAERGFNRPYSKVVVTNSGLI 342 K+IGDKRAVVAERGFNRPYSKVVVTN GLI Sbjct: 283 KVIGDKRAVVAERGFNRPYSKVVVTNCGLI 312 >ref|XP_002888963.1| peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein [Arabidopsis lyrata subsp. lyrata] gi|297334804|gb|EFH65222.1| peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein [Arabidopsis lyrata subsp. lyrata] Length = 318 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 431 KLIGDKRAVVAERGFNRPYSKVVVTNSGLI 342 K+IGDKRAVVAERGFNRPYSKVVVTN GLI Sbjct: 284 KVIGDKRAVVAERGFNRPYSKVVVTNCGLI 313 >ref|XP_002511993.1| peptidyl-prolyl cis-trans isomerase B, ppib, putative [Ricinus communis] gi|223549173|gb|EEF50662.1| peptidyl-prolyl cis-trans isomerase B, ppib, putative [Ricinus communis] Length = 329 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 431 KLIGDKRAVVAERGFNRPYSKVVVTNSGLI 342 KLIGDKRAVVAERGFNRPYSKVVVTN GL+ Sbjct: 299 KLIGDKRAVVAERGFNRPYSKVVVTNCGLM 328 >gb|AAL32738.1| Unknown protein [Arabidopsis thaliana] gi|20259950|gb|AAM13322.1| unknown protein [Arabidopsis thaliana] Length = 173 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 431 KLIGDKRAVVAERGFNRPYSKVVVTNSGLI 342 K+IGDKRAVVAERGFNRPYSKVVVTN GLI Sbjct: 139 KVIGDKRAVVAERGFNRPYSKVVVTNCGLI 168 >ref|XP_006600789.1| PREDICTED: uncharacterized protein LOC100796313 isoform X1 [Glycine max] gi|571535975|ref|XP_006600790.1| PREDICTED: uncharacterized protein LOC100796313 isoform X2 [Glycine max] Length = 350 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 431 KLIGDKRAVVAERGFNRPYSKVVVTNSGLI 342 KLIGDKRAVVAERGFNRPYSKV+VTN GL+ Sbjct: 320 KLIGDKRAVVAERGFNRPYSKVIVTNCGLM 349 >ref|XP_007155161.1| hypothetical protein PHAVU_003G178500g [Phaseolus vulgaris] gi|561028515|gb|ESW27155.1| hypothetical protein PHAVU_003G178500g [Phaseolus vulgaris] Length = 386 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 431 KLIGDKRAVVAERGFNRPYSKVVVTNSGLI 342 KLIGDKRAVVAERGFNRPYSKV+VTN GL+ Sbjct: 356 KLIGDKRAVVAERGFNRPYSKVIVTNCGLM 385 >ref|XP_004967980.1| PREDICTED: peptidyl-prolyl cis-trans isomerase, chloroplastic-like [Setaria italica] Length = 309 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 431 KLIGDKRAVVAERGFNRPYSKVVVTNSGLIS 339 KLIGDKRAVVAERGFNRPY+KVV+TN G++S Sbjct: 276 KLIGDKRAVVAERGFNRPYTKVVITNCGMLS 306 >ref|XP_003525643.1| PREDICTED: uncharacterized protein LOC100800469 [Glycine max] Length = 387 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 431 KLIGDKRAVVAERGFNRPYSKVVVTNSGLI 342 KLIGDKRAVVAERGFNRPYSKV+VTN GL+ Sbjct: 357 KLIGDKRAVVAERGFNRPYSKVIVTNCGLM 386 >ref|XP_003609079.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula] gi|357477653|ref|XP_003609112.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula] gi|355510134|gb|AES91276.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula] gi|355510167|gb|AES91309.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula] Length = 322 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 431 KLIGDKRAVVAERGFNRPYSKVVVTNSGLI 342 KLIGDKRAVVAERGFNRPYSKVV+TN G+I Sbjct: 292 KLIGDKRAVVAERGFNRPYSKVVITNCGVI 321 >ref|XP_002318560.1| peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein [Populus trichocarpa] gi|222859233|gb|EEE96780.1| peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein [Populus trichocarpa] Length = 328 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 431 KLIGDKRAVVAERGFNRPYSKVVVTNSGL 345 KLIGDKRAVVAERGFNRPYSKVVVTN GL Sbjct: 299 KLIGDKRAVVAERGFNRPYSKVVVTNCGL 327 >gb|ACJ83585.1| unknown [Medicago truncatula] gi|388522903|gb|AFK49513.1| unknown [Medicago truncatula] Length = 56 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 431 KLIGDKRAVVAERGFNRPYSKVVVTNSGLI 342 KLIGDKRAVVAERGFNRPYSKVV+TN G+I Sbjct: 26 KLIGDKRAVVAERGFNRPYSKVVITNCGVI 55 >ref|XP_004157426.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like [Cucumis sativus] Length = 253 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 431 KLIGDKRAVVAERGFNRPYSKVVVTNSGLI 342 K+IGDKRAVVAERGFNRPYSKV+VTN GL+ Sbjct: 222 KIIGDKRAVVAERGFNRPYSKVIVTNCGLL 251 >ref|XP_004137461.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like [Cucumis sativus] Length = 320 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 431 KLIGDKRAVVAERGFNRPYSKVVVTNSGLI 342 K+IGDKRAVVAERGFNRPYSKV+VTN GL+ Sbjct: 289 KIIGDKRAVVAERGFNRPYSKVIVTNCGLL 318 >gb|EXC28048.1| Peptidyl-prolyl cis-trans isomerase CYP20-1 [Morus notabilis] Length = 360 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 431 KLIGDKRAVVAERGFNRPYSKVVVTNSGLI 342 KLIGDKRAVVAERGFNRPYSKV+VTN GL+ Sbjct: 330 KLIGDKRAVVAERGFNRPYSKVLVTNCGLM 359 >ref|XP_006494257.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Citrus sinensis] Length = 322 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 431 KLIGDKRAVVAERGFNRPYSKVVVTNSGLI 342 KLIGDKRAVVAERGFNRPYSKV+VTN GL+ Sbjct: 292 KLIGDKRAVVAERGFNRPYSKVLVTNCGLM 321 >ref|XP_006440898.1| hypothetical protein CICLE_v10021171mg [Citrus clementina] gi|557543160|gb|ESR54138.1| hypothetical protein CICLE_v10021171mg [Citrus clementina] Length = 322 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 431 KLIGDKRAVVAERGFNRPYSKVVVTNSGLI 342 KLIGDKRAVVAERGFNRPYSKV+VTN GL+ Sbjct: 292 KLIGDKRAVVAERGFNRPYSKVLVTNCGLM 321 >ref|XP_006390469.1| hypothetical protein EUTSA_v10018882mg [Eutrema salsugineum] gi|557086903|gb|ESQ27755.1| hypothetical protein EUTSA_v10018882mg [Eutrema salsugineum] Length = 320 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 431 KLIGDKRAVVAERGFNRPYSKVVVTNSGLI 342 K+IGDKRAVVAERGFNRPYSKV+VTN GLI Sbjct: 288 KVIGDKRAVVAERGFNRPYSKVLVTNCGLI 317 >gb|EPS65914.1| hypothetical protein M569_08864, partial [Genlisea aurea] Length = 291 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 431 KLIGDKRAVVAERGFNRPYSKVVVTNSGLI 342 KLIGDKRAVVAERGFNRPYSKV++TN GL+ Sbjct: 262 KLIGDKRAVVAERGFNRPYSKVLITNCGLL 291