BLASTX nr result
ID: Mentha26_contig00021897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00021897 (445 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42028.1| hypothetical protein MIMGU_mgv1a008251mg [Mimulus... 56 6e-06 gb|EYU42027.1| hypothetical protein MIMGU_mgv1a008251mg [Mimulus... 56 6e-06 >gb|EYU42028.1| hypothetical protein MIMGU_mgv1a008251mg [Mimulus guttatus] Length = 378 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = -2 Query: 444 FLRELHVMSMRPCISNFFTTLISGGVVAFYLYRIIRDREQAGGS 313 F+REL MRP +N FTT ISGGVVAFYLYRII+D Q+G S Sbjct: 330 FVRELR---MRPFTANIFTTFISGGVVAFYLYRIIKDGGQSGAS 370 >gb|EYU42027.1| hypothetical protein MIMGU_mgv1a008251mg [Mimulus guttatus] Length = 379 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = -2 Query: 444 FLRELHVMSMRPCISNFFTTLISGGVVAFYLYRIIRDREQAGGS 313 F+REL MRP +N FTT ISGGVVAFYLYRII+D Q+G S Sbjct: 331 FVRELR---MRPFTANIFTTFISGGVVAFYLYRIIKDGGQSGAS 371