BLASTX nr result
ID: Mentha26_contig00021714
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00021714 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27075.1| hypothetical protein MIMGU_mgv1a014771mg [Mimulus... 82 8e-14 gb|EYU31355.1| hypothetical protein MIMGU_mgv1a014767mg [Mimulus... 77 3e-12 gb|EXC12840.1| Zinc finger A20 and AN1 domain-containing stress-... 74 2e-11 gb|EPS60935.1| induced stolon tip protein [Genlisea aurea] 74 2e-11 ref|XP_006345468.1| PREDICTED: zinc finger A20 and AN1 domain-co... 73 4e-11 ref|XP_004229613.1| PREDICTED: zinc finger A20 and AN1 domain-co... 73 4e-11 gb|ACR56827.1| At3g12630-like protein [Solanum hirtum] 73 4e-11 gb|ACR56824.1| At3g12630-like protein [Solanum hirtum] 73 4e-11 gb|ACM68451.1| stress-associated protein 1 [Solanum pennellii] 73 4e-11 ref|XP_004229612.1| PREDICTED: zinc finger A20 and AN1 domain-co... 73 4e-11 gb|AAR83854.1| induced stolon tip protein [Capsicum annuum] 73 4e-11 ref|XP_003633555.1| PREDICTED: zinc finger A20 and AN1 domain-co... 72 8e-11 gb|ACR56825.1| At3g12630-like protein [Solanum quitoense] gi|238... 71 1e-10 ref|XP_002314027.1| zinc finger family protein [Populus trichoca... 70 2e-10 ref|XP_002298442.1| zinc finger family protein [Populus trichoca... 70 3e-10 ref|XP_003546877.1| PREDICTED: zinc finger A20 and AN1 domain-co... 70 4e-10 ref|NP_001240258.1| zinc finger A20 and AN1 domain-containing st... 70 4e-10 ref|XP_006482901.1| PREDICTED: zinc finger A20 and AN1 domain-co... 69 5e-10 ref|XP_006438985.1| hypothetical protein CICLE_v10032882mg [Citr... 69 5e-10 ref|XP_004306522.1| PREDICTED: zinc finger A20 and AN1 domain-co... 69 5e-10 >gb|EYU27075.1| hypothetical protein MIMGU_mgv1a014771mg [Mimulus guttatus] Length = 178 Score = 82.0 bits (201), Expect = 8e-14 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +3 Query: 180 ASVAALPMKREANRCSGCRRKIGLTGFRCRCGELFCADHR 299 A+ AALP+KRE NRCSGCRRK+GLTGFRCRCG+LFCADHR Sbjct: 105 AAEAALPLKREVNRCSGCRRKVGLTGFRCRCGDLFCADHR 144 >gb|EYU31355.1| hypothetical protein MIMGU_mgv1a014767mg [Mimulus guttatus] Length = 179 Score = 77.0 bits (188), Expect = 3e-12 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +3 Query: 189 AALPMKREANRCSGCRRKIGLTGFRCRCGELFCADHR 299 AA P KRE NRC+GCRRK+GLTGFRCRCGELFCADHR Sbjct: 109 AAPPAKREVNRCTGCRRKVGLTGFRCRCGELFCADHR 145 >gb|EXC12840.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Morus notabilis] Length = 172 Score = 73.9 bits (180), Expect = 2e-11 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +3 Query: 192 ALPMKREANRCSGCRRKIGLTGFRCRCGELFCADHR 299 A+P KR NRCSGCRRK+GLTGFRCRCGELFCA+HR Sbjct: 103 AVPAKRVVNRCSGCRRKVGLTGFRCRCGELFCAEHR 138 >gb|EPS60935.1| induced stolon tip protein [Genlisea aurea] Length = 156 Score = 73.9 bits (180), Expect = 2e-11 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +3 Query: 183 SVAALPMKREANRCSGCRRKIGLTGFRCRCGELFCADHR 299 + AA P++R NRCSGCR+K+GLTGFRCRCGELFCA+HR Sbjct: 84 AAAARPLERSVNRCSGCRKKVGLTGFRCRCGELFCAEHR 122 >ref|XP_006345468.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Solanum tuberosum] Length = 187 Score = 73.2 bits (178), Expect = 4e-11 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 198 PMKREANRCSGCRRKIGLTGFRCRCGELFCADHR 299 P KRE NRCSGCRRK+GLTGFRCRCGELFC +HR Sbjct: 120 PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR 153 >ref|XP_004229613.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like isoform 2 [Solanum lycopersicum] Length = 159 Score = 73.2 bits (178), Expect = 4e-11 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 198 PMKREANRCSGCRRKIGLTGFRCRCGELFCADHR 299 P KRE NRCSGCRRK+GLTGFRCRCGELFC +HR Sbjct: 92 PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR 125 >gb|ACR56827.1| At3g12630-like protein [Solanum hirtum] Length = 151 Score = 73.2 bits (178), Expect = 4e-11 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 198 PMKREANRCSGCRRKIGLTGFRCRCGELFCADHR 299 P KRE NRCSGCRRK+GLTGFRCRCGELFC +HR Sbjct: 90 PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR 123 >gb|ACR56824.1| At3g12630-like protein [Solanum hirtum] Length = 147 Score = 73.2 bits (178), Expect = 4e-11 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 198 PMKREANRCSGCRRKIGLTGFRCRCGELFCADHR 299 P KRE NRCSGCRRK+GLTGFRCRCGELFC +HR Sbjct: 86 PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR 119 >gb|ACM68451.1| stress-associated protein 1 [Solanum pennellii] Length = 87 Score = 73.2 bits (178), Expect = 4e-11 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 198 PMKREANRCSGCRRKIGLTGFRCRCGELFCADHR 299 P KRE NRCSGCRRK+GLTGFRCRCGELFC +HR Sbjct: 20 PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR 53 >ref|XP_004229612.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like isoform 1 [Solanum lycopersicum] gi|88866527|gb|ABD57310.1| stress-associated protein 1 [Solanum lycopersicum] Length = 188 Score = 73.2 bits (178), Expect = 4e-11 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 198 PMKREANRCSGCRRKIGLTGFRCRCGELFCADHR 299 P KRE NRCSGCRRK+GLTGFRCRCGELFC +HR Sbjct: 121 PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR 154 >gb|AAR83854.1| induced stolon tip protein [Capsicum annuum] Length = 88 Score = 73.2 bits (178), Expect = 4e-11 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 198 PMKREANRCSGCRRKIGLTGFRCRCGELFCADHR 299 P KRE NRCSGCRRK+GLTGFRCRCGELFC +HR Sbjct: 21 PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR 54 >ref|XP_003633555.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Vitis vinifera] Length = 172 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/44 (72%), Positives = 37/44 (84%), Gaps = 4/44 (9%) Frame = +3 Query: 180 ASVAALP----MKREANRCSGCRRKIGLTGFRCRCGELFCADHR 299 AS AA+ +KRE NRCSGCRRK+GLTGFRCRCG+LFCA+HR Sbjct: 95 ASAAAVEEVGKVKREVNRCSGCRRKVGLTGFRCRCGDLFCAEHR 138 >gb|ACR56825.1| At3g12630-like protein [Solanum quitoense] gi|238816903|gb|ACR56826.1| At3g12630-like protein [Solanum quitoense] Length = 150 Score = 71.2 bits (173), Expect = 1e-10 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 198 PMKREANRCSGCRRKIGLTGFRCRCGELFCADHR 299 P KRE +RCSGCRRK+GLTGFRCRCGELFC +HR Sbjct: 89 PAKREVSRCSGCRRKVGLTGFRCRCGELFCGEHR 122 >ref|XP_002314027.1| zinc finger family protein [Populus trichocarpa] gi|222850435|gb|EEE87982.1| zinc finger family protein [Populus trichocarpa] Length = 179 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 174 KEASVAALPMKREANRCSGCRRKIGLTGFRCRCGELFCADHR 299 KE S A K+E NRCSGCRR++GLTGFRCRCGELFC +HR Sbjct: 104 KERSCAYHVAKKEVNRCSGCRRRVGLTGFRCRCGELFCWEHR 145 >ref|XP_002298442.1| zinc finger family protein [Populus trichocarpa] gi|118486081|gb|ABK94884.1| unknown [Populus trichocarpa] gi|222845700|gb|EEE83247.1| zinc finger family protein [Populus trichocarpa] Length = 181 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +3 Query: 174 KEASVAALPMKREANRCSGCRRKIGLTGFRCRCGELFCADHR 299 KE S ++ K+E NRCSGCRR++GLTGFRCRCGELFC +HR Sbjct: 106 KERSDSSSVAKKEVNRCSGCRRRVGLTGFRCRCGELFCWEHR 147 >ref|XP_003546877.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Glycine max] Length = 161 Score = 69.7 bits (169), Expect = 4e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 204 KREANRCSGCRRKIGLTGFRCRCGELFCADHR 299 KR NRCSGCRRK+GLTGFRCRCGELFCA+HR Sbjct: 96 KRVVNRCSGCRRKVGLTGFRCRCGELFCAEHR 127 >ref|NP_001240258.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Glycine max] gi|300510880|gb|ADK25058.1| AN1-like transcription factor [Glycine max] Length = 164 Score = 69.7 bits (169), Expect = 4e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 204 KREANRCSGCRRKIGLTGFRCRCGELFCADHR 299 KR NRCSGCRRK+GLTGFRCRCGELFCA+HR Sbjct: 99 KRVVNRCSGCRRKVGLTGFRCRCGELFCAEHR 130 >ref|XP_006482901.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Citrus sinensis] Length = 178 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = +3 Query: 174 KEASVAALPMKREANRCSGCRRKIGLTGFRCRCGELFCADHR 299 KEA+V KR NRCSGCRRK+GLTGFRCRCGELFC +HR Sbjct: 107 KEANVE----KRVVNRCSGCRRKVGLTGFRCRCGELFCGEHR 144 >ref|XP_006438985.1| hypothetical protein CICLE_v10032882mg [Citrus clementina] gi|557541181|gb|ESR52225.1| hypothetical protein CICLE_v10032882mg [Citrus clementina] Length = 179 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = +3 Query: 174 KEASVAALPMKREANRCSGCRRKIGLTGFRCRCGELFCADHR 299 KEA+V KR NRCSGCRRK+GLTGFRCRCGELFC +HR Sbjct: 108 KEANVE----KRVVNRCSGCRRKVGLTGFRCRCGELFCGEHR 145 >ref|XP_004306522.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Fragaria vesca subsp. vesca] Length = 170 Score = 69.3 bits (168), Expect = 5e-10 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 201 MKREANRCSGCRRKIGLTGFRCRCGELFCADHR 299 M+R NRCSGCRRK+GLTGFRCRCGELFC++HR Sbjct: 104 MRRVVNRCSGCRRKVGLTGFRCRCGELFCSEHR 136