BLASTX nr result
ID: Mentha26_contig00021637
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00021637 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002446095.1| hypothetical protein SORBIDRAFT_06g001660 [S... 60 2e-07 ref|XP_002445319.1| hypothetical protein SORBIDRAFT_07g009320 [S... 59 7e-07 ref|XP_002453068.1| hypothetical protein SORBIDRAFT_04g037770 [S... 59 7e-07 ref|XP_002438210.1| hypothetical protein SORBIDRAFT_10g009598 [S... 57 2e-06 gb|ABF70031.1| DNA helicase homolog, putative [Musa acuminata] 57 2e-06 gb|EYU17650.1| hypothetical protein MIMGU_mgv11b020521mg, partia... 57 3e-06 ref|XP_002460254.1| hypothetical protein SORBIDRAFT_02g025543 [S... 57 3e-06 ref|XP_002440837.1| hypothetical protein SORBIDRAFT_09g008040 [S... 55 8e-06 >ref|XP_002446095.1| hypothetical protein SORBIDRAFT_06g001660 [Sorghum bicolor] gi|241937278|gb|EES10423.1| hypothetical protein SORBIDRAFT_06g001660 [Sorghum bicolor] Length = 1484 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/48 (52%), Positives = 31/48 (64%) Frame = -1 Query: 180 ETWQLPPKDPCPYCKAIRFANEPPGFCCASGKIEIQVPKMPNELWNLY 37 ET L P C +C A RF EPPGFCC SGK+E+ P +PN+L L+ Sbjct: 63 ETHMLKPVPDCKHCGAKRFPKEPPGFCCRSGKVELNAPVIPNQLMRLW 110 >ref|XP_002445319.1| hypothetical protein SORBIDRAFT_07g009320 [Sorghum bicolor] gi|241941669|gb|EES14814.1| hypothetical protein SORBIDRAFT_07g009320 [Sorghum bicolor] Length = 1342 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/48 (50%), Positives = 31/48 (64%) Frame = -1 Query: 180 ETWQLPPKDPCPYCKAIRFANEPPGFCCASGKIEIQVPKMPNELWNLY 37 ET L P C +C A RF EPPGFCC +GK+E+ P +PN+L L+ Sbjct: 256 ETHMLKPVPDCHHCGAKRFPKEPPGFCCRNGKVELNAPVVPNQLMRLW 303 >ref|XP_002453068.1| hypothetical protein SORBIDRAFT_04g037770 [Sorghum bicolor] gi|241932899|gb|EES06044.1| hypothetical protein SORBIDRAFT_04g037770 [Sorghum bicolor] Length = 1275 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/48 (50%), Positives = 30/48 (62%) Frame = -1 Query: 180 ETWQLPPKDPCPYCKAIRFANEPPGFCCASGKIEIQVPKMPNELWNLY 37 ET L P C +C RF EPPGFCC SGK+E+ P +PN+L L+ Sbjct: 261 ETHMLKPVPDCKHCGVKRFPKEPPGFCCRSGKVELHAPVIPNQLMRLW 308 >ref|XP_002438210.1| hypothetical protein SORBIDRAFT_10g009598 [Sorghum bicolor] gi|241916433|gb|EER89577.1| hypothetical protein SORBIDRAFT_10g009598 [Sorghum bicolor] Length = 521 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/50 (48%), Positives = 33/50 (66%) Frame = -1 Query: 183 TETWQLPPKDPCPYCKAIRFANEPPGFCCASGKIEIQVPKMPNELWNLYA 34 T+T L P C +C A RF +E PGFCC SGK+E+ P +P+EL L++ Sbjct: 247 TDTHMLKPVTNCNHCDAKRFEHESPGFCCRSGKVELNDPNVPDELMRLWS 296 >gb|ABF70031.1| DNA helicase homolog, putative [Musa acuminata] Length = 1605 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/50 (48%), Positives = 33/50 (66%) Frame = -1 Query: 183 TETWQLPPKDPCPYCKAIRFANEPPGFCCASGKIEIQVPKMPNELWNLYA 34 TET +L C +C A RF EPPGFCC SGK+E+ P +P++L L++ Sbjct: 223 TETHKLKSVPNCHHCGAKRFPKEPPGFCCRSGKVELNAPVIPSQLMRLWS 272 >gb|EYU17650.1| hypothetical protein MIMGU_mgv11b020521mg, partial [Mimulus guttatus] Length = 445 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/81 (35%), Positives = 39/81 (48%) Frame = -1 Query: 243 SSRYAMQEDVEMFRRLIEISTETWQLPPKDPCPYCKAIRFANEPPGFCCASGKIEIQVPK 64 S + +E F+ + + W LP +D C YC A RF E GFCCASG+I Sbjct: 173 SESFVSPLSIEQFKGIQSVYQSPWFLPKEDICEYCGAYRFYRECAGFCCASGQILFPKSA 232 Query: 63 MPNELWNLYAIDMTPLGVEFR 1 +W L+ + L VEFR Sbjct: 233 YCPIMWFLFTSVESELAVEFR 253 >ref|XP_002460254.1| hypothetical protein SORBIDRAFT_02g025543 [Sorghum bicolor] gi|241923631|gb|EER96775.1| hypothetical protein SORBIDRAFT_02g025543 [Sorghum bicolor] Length = 1286 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/49 (48%), Positives = 32/49 (65%) Frame = -1 Query: 180 ETWQLPPKDPCPYCKAIRFANEPPGFCCASGKIEIQVPKMPNELWNLYA 34 ET +L C +C A RF EPPGFCC SGK+E+ P +PN+L L++ Sbjct: 219 ETHKLKSIPNCHHCGAKRFPKEPPGFCCRSGKVELNAPVIPNQLMRLWS 267 >ref|XP_002440837.1| hypothetical protein SORBIDRAFT_09g008040 [Sorghum bicolor] gi|241946122|gb|EES19267.1| hypothetical protein SORBIDRAFT_09g008040 [Sorghum bicolor] Length = 1679 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/48 (47%), Positives = 31/48 (64%) Frame = -1 Query: 180 ETWQLPPKDPCPYCKAIRFANEPPGFCCASGKIEIQVPKMPNELWNLY 37 E ++L C YC AIRF E PGFCC GK++I +P +P+EL L+ Sbjct: 277 ERYKLRNVPDCSYCGAIRFQYETPGFCCRKGKVQIHIPDVPSELKRLF 324