BLASTX nr result
ID: Mentha26_contig00021574
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00021574 (410 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007144753.1| hypothetical protein PHAVU_007G181800g [Phas... 57 4e-06 >ref|XP_007144753.1| hypothetical protein PHAVU_007G181800g [Phaseolus vulgaris] gi|561017943|gb|ESW16747.1| hypothetical protein PHAVU_007G181800g [Phaseolus vulgaris] Length = 372 Score = 56.6 bits (135), Expect = 4e-06 Identities = 33/75 (44%), Positives = 43/75 (57%), Gaps = 1/75 (1%) Frame = -2 Query: 295 RMKTPN-THKHAPIPFFAVAFLLLTTAGAQSGPTPDTNPNMYARFSPSMXXXXXXXXXXL 119 +MK N ++K+ I FF + L++ A AQS + N + Y RFSPSM + Sbjct: 3 QMKNTNGSNKNGGIYFFLLLLLIVPLAAAQSSDN-NQNTSYYNRFSPSMAIIIVILIAAV 61 Query: 118 FFMGFFSIYIRHCYD 74 F MGFFSIYIRHC D Sbjct: 62 FLMGFFSIYIRHCAD 76