BLASTX nr result
ID: Mentha26_contig00021572
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00021572 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM60957.1| RING-H2 zinc finger protein-like [Arabidopsis tha... 59 9e-07 ref|NP_198094.1| E3 ubiquitin-protein ligase ATL31 [Arabidopsis ... 59 9e-07 >gb|AAM60957.1| RING-H2 zinc finger protein-like [Arabidopsis thaliana] Length = 368 Score = 58.5 bits (140), Expect = 9e-07 Identities = 34/69 (49%), Positives = 41/69 (59%), Gaps = 3/69 (4%) Frame = -3 Query: 263 PYKHASIPFVAVAFLLLTTAGAQPGSTPDNNPNMYA---RFSPSMXXXXXXXXXXLFFMG 93 P KH S+P V V FLLL+ + QPG TPD + YA SP+M LFFMG Sbjct: 3 PIKHISLP-VLVLFLLLSVSAGQPG-TPDQRHDPYAYSGSLSPAMAVVVVVVIAALFFMG 60 Query: 92 FFSIYIRHC 66 FF++YIRHC Sbjct: 61 FFTVYIRHC 69 >ref|NP_198094.1| E3 ubiquitin-protein ligase ATL31 [Arabidopsis thaliana] gi|68565208|sp|Q8LGA5.2|ATL31_ARATH RecName: Full=E3 ubiquitin-protein ligase ATL31; AltName: Full=Protein CARBON/NITROGEN INSENSITIVE 1; AltName: Full=Protein SUPER SURVIVAL 1; AltName: Full=RING-H2 finger protein ATL31; Flags: Precursor gi|110742271|dbj|BAE99061.1| RING-H2 zinc finger protein-like [Arabidopsis thaliana] gi|332006302|gb|AED93685.1| E3 ubiquitin-protein ligase ATL31 [Arabidopsis thaliana] Length = 368 Score = 58.5 bits (140), Expect = 9e-07 Identities = 34/69 (49%), Positives = 41/69 (59%), Gaps = 3/69 (4%) Frame = -3 Query: 263 PYKHASIPFVAVAFLLLTTAGAQPGSTPDNNPNMYA---RFSPSMXXXXXXXXXXLFFMG 93 P KH S+P V V FLLL+ + QPG TPD + YA SP+M LFFMG Sbjct: 3 PIKHISLP-VLVLFLLLSVSAGQPG-TPDQRHDPYAYSGSLSPAMAVVVVVVIAALFFMG 60 Query: 92 FFSIYIRHC 66 FF++YIRHC Sbjct: 61 FFTVYIRHC 69