BLASTX nr result
ID: Mentha26_contig00021417
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00021417 (715 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20099.1| hypothetical protein MIMGU_mgv1a007074mg [Mimulus... 61 3e-07 >gb|EYU20099.1| hypothetical protein MIMGU_mgv1a007074mg [Mimulus guttatus] Length = 420 Score = 61.2 bits (147), Expect = 3e-07 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = +3 Query: 234 EGYAACRSHIATNAIKTNCSMVDCVRLAKELR-VAADEKLRAYIES 368 EGYAA RSHIA NAIKTNC MV+CVRL KE ++ADEK IE+ Sbjct: 375 EGYAATRSHIALNAIKTNCPMVECVRLVKEFHSMSADEKSHGLIEA 420