BLASTX nr result
ID: Mentha26_contig00021412
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00021412 (567 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46564.1| hypothetical protein MIMGU_mgv1a013988mg [Mimulus... 71 2e-10 gb|EPS72551.1| hypothetical protein M569_02211 [Genlisea aurea] 63 5e-08 >gb|EYU46564.1| hypothetical protein MIMGU_mgv1a013988mg [Mimulus guttatus] gi|604348410|gb|EYU46565.1| hypothetical protein MIMGU_mgv1a013988mg [Mimulus guttatus] Length = 204 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/47 (65%), Positives = 36/47 (76%), Gaps = 2/47 (4%) Frame = -2 Query: 137 HHRNHHQYYGRNHG--HHSTNSYGSPPSESFRGISCRTFQSGAGLLP 3 HHRNHHQYYGR+ + S+GSPPS FRGI+CRTF+SG GLLP Sbjct: 9 HHRNHHQYYGRSRSRSYAKLRSFGSPPSGGFRGINCRTFESGEGLLP 55 >gb|EPS72551.1| hypothetical protein M569_02211 [Genlisea aurea] Length = 193 Score = 63.2 bits (152), Expect = 5e-08 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 2/47 (4%) Frame = -2 Query: 137 HHRNHHQYYGRNHGHHSTNS--YGSPPSESFRGISCRTFQSGAGLLP 3 HH++ HQYY R+ GH + + SPPS+ FRGI+CR F+SG GLLP Sbjct: 8 HHKSSHQYYRRSRGHEPSKDAYFASPPSDGFRGITCRAFESGGGLLP 54