BLASTX nr result
ID: Mentha26_contig00021347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00021347 (372 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_717175.1| ribosomal protein S4 [Brassica napus] gi|375911... 62 1e-07 sp|Q31708.2|RT04_ARATH RecName: Full=Ribosomal protein S4, mitoc... 62 1e-07 gb|ACH78250.1| ribosomal protein S4 [Arabidopsis thaliana] 62 1e-07 ref|YP_008802509.1| ribosomal protein S4 (mitochondrion) [Asclep... 61 2e-07 ref|YP_005090486.1| ribosomal protein S4 (mitochondrion) [Lotus ... 61 2e-07 ref|YP_005090450.1| ribosomal protein S4 (mitochondrion) [Millet... 61 2e-07 dbj|BAD83538.2| ribosomal protein S4, partial (mitochondrion) [N... 61 2e-07 ref|YP_002000578.1| ribosomal protein S4 [Oryza sativa Japonica ... 61 2e-07 ref|YP_004222288.1| ribosomal protein S4 [Beta vulgaris subsp. m... 60 3e-07 ref|NP_064046.2| rps4 gene product (mitochondrion) [Beta vulgari... 60 3e-07 gb|EPS74675.1| hypothetical protein M569_00050 [Genlisea aurea] 58 2e-06 ref|YP_005090421.1| rps4 gene product (mitochondrion) [Boea hygr... 55 8e-06 >ref|YP_717175.1| ribosomal protein S4 [Brassica napus] gi|37591124|dbj|BAC98926.1| ribosomal protein S4 [Brassica napus] Length = 362 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -1 Query: 372 THYLEVNHKIQKAIMFYGPHIAHIPLHVSMKDLNLLCWSEYER 244 THYLEVN++ KA++FYGP+I HIP + +KDLNLL WS R Sbjct: 316 THYLEVNYRTPKAVVFYGPNIGHIPHDIRLKDLNLLLWSRNGR 358 >sp|Q31708.2|RT04_ARATH RecName: Full=Ribosomal protein S4, mitochondrial Length = 362 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -1 Query: 372 THYLEVNHKIQKAIMFYGPHIAHIPLHVSMKDLNLLCWSEYER 244 THYLEVN++ KA++FYGP+I HIP + +KDLNLL WS R Sbjct: 316 THYLEVNYRTPKAVVFYGPNIGHIPHDIRLKDLNLLLWSRNGR 358 >gb|ACH78250.1| ribosomal protein S4 [Arabidopsis thaliana] Length = 362 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -1 Query: 372 THYLEVNHKIQKAIMFYGPHIAHIPLHVSMKDLNLLCWSEYER 244 THYLEVN++ KA++FYGP+I HIP + +KDLNLL WS R Sbjct: 316 THYLEVNYRTPKAVVFYGPNIGHIPHDIRLKDLNLLLWSRNGR 358 >ref|YP_008802509.1| ribosomal protein S4 (mitochondrion) [Asclepias syriaca] gi|556562347|gb|AGZ63043.1| ribosomal protein S4 (mitochondrion) [Asclepias syriaca] Length = 274 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -1 Query: 372 THYLEVNHKIQKAIMFYGPHIAHIPLHVSMKDLNLLCWS 256 THYLEVN++ KA++FYGP+I HIP + +KDLNLL WS Sbjct: 228 THYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDLNLLLWS 266 >ref|YP_005090486.1| ribosomal protein S4 (mitochondrion) [Lotus japonicus] gi|357197350|gb|AET62946.1| ribosomal protein S4 (mitochondrion) [Lotus japonicus] Length = 358 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -1 Query: 372 THYLEVNHKIQKAIMFYGPHIAHIPLHVSMKDLNLLCWS 256 THYLEVN++ KA++FYGP+I HIP + +KDLNLL WS Sbjct: 312 THYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDLNLLLWS 350 >ref|YP_005090450.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gi|372450274|ref|YP_005090457.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gi|357197313|gb|AET62910.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gi|357197320|gb|AET62917.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] Length = 358 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -1 Query: 372 THYLEVNHKIQKAIMFYGPHIAHIPLHVSMKDLNLLCWS 256 THYLEVN++ KA++FYGP+I HIP + +KDLNLL WS Sbjct: 312 THYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDLNLLLWS 350 >dbj|BAD83538.2| ribosomal protein S4, partial (mitochondrion) [Nicotiana tabacum] Length = 349 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -1 Query: 372 THYLEVNHKIQKAIMFYGPHIAHIPLHVSMKDLNLLCWS 256 THYLEVN++ KA++FYGP+I HIP + +KDLNLL WS Sbjct: 303 THYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDLNLLLWS 341 >ref|YP_002000578.1| ribosomal protein S4 [Oryza sativa Japonica Group] gi|92700092|dbj|BAC19883.2| Ribosomal protein S4 [Oryza sativa Japonica Group] Length = 352 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -1 Query: 372 THYLEVNHKIQKAIMFYGPHIAHIPLHVSMKDLNLLCWS 256 THYLEVN++ KA++FYGP+I HIP + +KDLNLL WS Sbjct: 306 THYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDLNLLLWS 344 >ref|YP_004222288.1| ribosomal protein S4 [Beta vulgaris subsp. maritima] gi|317905723|emb|CBJ14108.1| ribosomal protein S4 [Beta vulgaris subsp. maritima] gi|319439803|emb|CBJ17515.1| ribosomal protein S4 [Beta vulgaris subsp. maritima] Length = 315 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -1 Query: 372 THYLEVNHKIQKAIMFYGPHIAHIPLHVSMKDLNLLCWS 256 THY EVNH+ KA++FYGP+I HIP + +KDLNLL WS Sbjct: 269 THYSEVNHRTLKAVVFYGPNIDHIPHDIRLKDLNLLLWS 307 >ref|NP_064046.2| rps4 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|346683270|ref|YP_004842202.1| ribosomal protein S4 [Beta macrocarpa] gi|87248052|gb|ABD36080.1| ribosomal protein S4 [Beta vulgaris subsp. vulgaris] gi|148491424|dbj|BAA99356.2| ribosomal protein S4 [Beta vulgaris subsp. vulgaris] gi|320148708|emb|CBJ23346.1| ribosomal protein S4 [Beta vulgaris subsp. maritima] gi|345500188|emb|CBX25007.1| ribosomal protein S4 [Beta macrocarpa] gi|384939188|emb|CBL52035.1| ribosoma lprotein S4 (mitochondrion) [Beta vulgaris subsp. maritima] Length = 315 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -1 Query: 372 THYLEVNHKIQKAIMFYGPHIAHIPLHVSMKDLNLLCWS 256 THY EVNH+ KA++FYGP+I HIP + +KDLNLL WS Sbjct: 269 THYSEVNHRTLKAVVFYGPNIDHIPHDIRLKDLNLLLWS 307 >gb|EPS74675.1| hypothetical protein M569_00050 [Genlisea aurea] Length = 354 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = -1 Query: 372 THYLEVNHKIQKAIMFYGPHIAHIPLHVSMKDLNLLCWSEYER 244 THYLEVNH+ QKA++ YGP+I HIP + +KD NLL S ER Sbjct: 308 THYLEVNHRTQKAVVSYGPNIGHIPHDIRLKDPNLLLRSRNER 350 >ref|YP_005090421.1| rps4 gene product (mitochondrion) [Boea hygrometrica] gi|340549497|gb|AEK53318.1| ribosomal protein S4 (mitochondrion) [Boea hygrometrica] Length = 329 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/43 (58%), Positives = 31/43 (72%) Frame = -1 Query: 372 THYLEVNHKIQKAIMFYGPHIAHIPLHVSMKDLNLLCWSEYER 244 THY EVNH+ KA++FYGP+I HIP + +KD NLL S ER Sbjct: 283 THYSEVNHRTPKAVVFYGPNIGHIPHDIRLKDPNLLLRSGNER 325