BLASTX nr result
ID: Mentha26_contig00021238
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00021238 (348 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42377.1| hypothetical protein MIMGU_mgv1a022487mg, partial... 59 5e-07 >gb|EYU42377.1| hypothetical protein MIMGU_mgv1a022487mg, partial [Mimulus guttatus] Length = 182 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/71 (46%), Positives = 48/71 (67%), Gaps = 6/71 (8%) Frame = +2 Query: 152 GCR---SYASASASETYGGREASLDDSYG--GGPTSTSLWSPENTSSGEDYTKTSGEDRG 316 GC+ + +AS S T+GGR+ S + GG TSTS+WSPENTSSG++Y++TS +D Sbjct: 58 GCKVVGATTAASESATFGGRDDSFQLTLDTCGGLTSTSMWSPENTSSGKEYSRTSADDHD 117 Query: 317 FV-TQSRSQRQ 346 + +SRSQ + Sbjct: 118 YSGCRSRSQSE 128