BLASTX nr result
ID: Mentha26_contig00021032
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00021032 (306 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004303854.1| PREDICTED: probable rhamnose biosynthetic en... 107 1e-21 ref|XP_004244296.1| PREDICTED: probable rhamnose biosynthetic en... 106 4e-21 ref|XP_004294169.1| PREDICTED: probable rhamnose biosynthetic en... 105 5e-21 gb|EXB54072.1| putative rhamnose biosynthetic enzyme 1 [Morus no... 105 7e-21 ref|XP_004137224.1| PREDICTED: probable rhamnose biosynthetic en... 105 7e-21 ref|XP_006585327.1| PREDICTED: probable rhamnose biosynthetic en... 105 9e-21 ref|XP_006585326.1| PREDICTED: probable rhamnose biosynthetic en... 105 9e-21 ref|XP_006389974.1| hypothetical protein EUTSA_v10018232mg [Eutr... 105 9e-21 ref|XP_004488984.1| PREDICTED: probable rhamnose biosynthetic en... 105 9e-21 ref|XP_003531412.1| PREDICTED: probable rhamnose biosynthetic en... 105 9e-21 ref|XP_002887744.1| RHM1/ROL1 [Arabidopsis lyrata subsp. lyrata]... 105 9e-21 ref|XP_006348335.1| PREDICTED: probable rhamnose biosynthetic en... 104 1e-20 ref|XP_006442344.1| hypothetical protein CICLE_v10019182mg [Citr... 104 1e-20 ref|XP_006301908.1| hypothetical protein CARUB_v10022384mg [Caps... 103 2e-20 ref|XP_004248232.1| PREDICTED: probable rhamnose biosynthetic en... 103 2e-20 ref|XP_003546628.1| PREDICTED: probable rhamnose biosynthetic en... 103 2e-20 ref|XP_003543185.1| PREDICTED: probable rhamnose biosynthetic en... 103 2e-20 gb|EYU26294.1| hypothetical protein MIMGU_mgv1a002474mg [Mimulus... 103 2e-20 ref|XP_006306947.1| hypothetical protein CARUB_v10008513mg [Caps... 103 2e-20 ref|XP_006649857.1| PREDICTED: probable rhamnose biosynthetic en... 103 3e-20 >ref|XP_004303854.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Fragaria vesca subsp. vesca] Length = 679 Score = 107 bits (268), Expect = 1e-21 Identities = 54/56 (96%), Positives = 54/56 (96%) Frame = +2 Query: 5 FKWSNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKTSA 172 FKW NFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKTSA Sbjct: 619 FKWVNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKTSA 674 >ref|XP_004244296.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Solanum lycopersicum] Length = 674 Score = 106 bits (264), Expect = 4e-21 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = +2 Query: 2 DFKWSNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKTSA 172 +FKWSNFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIKESLIK VFEPN+KTSA Sbjct: 618 EFKWSNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKNVFEPNRKTSA 674 >ref|XP_004294169.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Fragaria vesca subsp. vesca] Length = 671 Score = 105 bits (263), Expect = 5e-21 Identities = 53/56 (94%), Positives = 55/56 (98%) Frame = +2 Query: 5 FKWSNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKTSA 172 FK+SNFT+EEQAKVIVAARSNNEMDASKLKKEFPELL IKESLIKYVFEPNKKTSA Sbjct: 615 FKYSNFTIEEQAKVIVAARSNNEMDASKLKKEFPELLPIKESLIKYVFEPNKKTSA 670 >gb|EXB54072.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis] Length = 671 Score = 105 bits (262), Expect = 7e-21 Identities = 52/57 (91%), Positives = 52/57 (91%) Frame = +2 Query: 2 DFKWSNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKTSA 172 DF W NFTLEEQAKVIVA RSNNEMD SKLKKEFPELL IKESLIKYVFEPNKKTSA Sbjct: 614 DFSWENFTLEEQAKVIVAPRSNNEMDTSKLKKEFPELLPIKESLIKYVFEPNKKTSA 670 >ref|XP_004137224.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis sativus] gi|449483174|ref|XP_004156513.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis sativus] Length = 670 Score = 105 bits (262), Expect = 7e-21 Identities = 51/57 (89%), Positives = 54/57 (94%) Frame = +2 Query: 2 DFKWSNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKTSA 172 +FKW+NFTLEEQAKVIVA RSNNEMDASKLK EFPE+L IKESLIKYVFEPNKKTSA Sbjct: 614 EFKWANFTLEEQAKVIVAPRSNNEMDASKLKNEFPEMLGIKESLIKYVFEPNKKTSA 670 >ref|XP_006585327.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X3 [Glycine max] Length = 690 Score = 105 bits (261), Expect = 9e-21 Identities = 52/55 (94%), Positives = 53/55 (96%) Frame = +2 Query: 2 DFKWSNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKT 166 +FKWSNFTLEEQAKVIVA RSNNEMDASKLK EFPELLSIKESLIKYVFEPNKKT Sbjct: 636 NFKWSNFTLEEQAKVIVAPRSNNEMDASKLKTEFPELLSIKESLIKYVFEPNKKT 690 >ref|XP_006585326.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X2 [Glycine max] Length = 691 Score = 105 bits (261), Expect = 9e-21 Identities = 52/55 (94%), Positives = 53/55 (96%) Frame = +2 Query: 2 DFKWSNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKT 166 +FKWSNFTLEEQAKVIVA RSNNEMDASKLK EFPELLSIKESLIKYVFEPNKKT Sbjct: 637 NFKWSNFTLEEQAKVIVAPRSNNEMDASKLKTEFPELLSIKESLIKYVFEPNKKT 691 >ref|XP_006389974.1| hypothetical protein EUTSA_v10018232mg [Eutrema salsugineum] gi|557086408|gb|ESQ27260.1| hypothetical protein EUTSA_v10018232mg [Eutrema salsugineum] Length = 669 Score = 105 bits (261), Expect = 9e-21 Identities = 51/55 (92%), Positives = 53/55 (96%) Frame = +2 Query: 2 DFKWSNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKT 166 +FKW+NFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIKESLIKY FEPNKKT Sbjct: 615 EFKWANFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKYAFEPNKKT 669 >ref|XP_004488984.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X1 [Cicer arietinum] gi|502089679|ref|XP_004488985.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X2 [Cicer arietinum] Length = 670 Score = 105 bits (261), Expect = 9e-21 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = +2 Query: 2 DFKWSNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKTS 169 +FKW+NFTLEEQAKVIVAARSNNEMDASKLK EFPELLSIKESLIKYVFEPNKK++ Sbjct: 615 NFKWANFTLEEQAKVIVAARSNNEMDASKLKNEFPELLSIKESLIKYVFEPNKKSA 670 >ref|XP_003531412.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X1 [Glycine max] gi|571471508|ref|XP_006585328.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X4 [Glycine max] gi|571471510|ref|XP_006585329.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X5 [Glycine max] gi|571471512|ref|XP_006585330.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X6 [Glycine max] Length = 668 Score = 105 bits (261), Expect = 9e-21 Identities = 52/55 (94%), Positives = 53/55 (96%) Frame = +2 Query: 2 DFKWSNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKT 166 +FKWSNFTLEEQAKVIVA RSNNEMDASKLK EFPELLSIKESLIKYVFEPNKKT Sbjct: 614 NFKWSNFTLEEQAKVIVAPRSNNEMDASKLKTEFPELLSIKESLIKYVFEPNKKT 668 >ref|XP_002887744.1| RHM1/ROL1 [Arabidopsis lyrata subsp. lyrata] gi|297333585|gb|EFH64003.1| RHM1/ROL1 [Arabidopsis lyrata subsp. lyrata] Length = 669 Score = 105 bits (261), Expect = 9e-21 Identities = 51/55 (92%), Positives = 53/55 (96%) Frame = +2 Query: 2 DFKWSNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKT 166 +FKW+NFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIKESLIKY FEPNKKT Sbjct: 615 EFKWANFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKYAFEPNKKT 669 >ref|XP_006348335.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Solanum tuberosum] Length = 674 Score = 104 bits (259), Expect = 1e-20 Identities = 51/57 (89%), Positives = 55/57 (96%) Frame = +2 Query: 2 DFKWSNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKTSA 172 +FKWSNFTL+EQAKV+VA RSNNEMDASKLKKEFPELLSIKESLIK VFEPN+KTSA Sbjct: 618 EFKWSNFTLDEQAKVLVAPRSNNEMDASKLKKEFPELLSIKESLIKNVFEPNRKTSA 674 >ref|XP_006442344.1| hypothetical protein CICLE_v10019182mg [Citrus clementina] gi|567899714|ref|XP_006442345.1| hypothetical protein CICLE_v10019182mg [Citrus clementina] gi|567899716|ref|XP_006442346.1| hypothetical protein CICLE_v10019182mg [Citrus clementina] gi|557544606|gb|ESR55584.1| hypothetical protein CICLE_v10019182mg [Citrus clementina] gi|557544607|gb|ESR55585.1| hypothetical protein CICLE_v10019182mg [Citrus clementina] gi|557544608|gb|ESR55586.1| hypothetical protein CICLE_v10019182mg [Citrus clementina] Length = 668 Score = 104 bits (259), Expect = 1e-20 Identities = 51/55 (92%), Positives = 53/55 (96%) Frame = +2 Query: 2 DFKWSNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKT 166 +FKW NFTLEEQAKVIVA RSNNEMDASKLKKEFPELLSIK+SLIKYVFEPNKKT Sbjct: 614 EFKWVNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKDSLIKYVFEPNKKT 668 >ref|XP_006301908.1| hypothetical protein CARUB_v10022384mg [Capsella rubella] gi|482570618|gb|EOA34806.1| hypothetical protein CARUB_v10022384mg [Capsella rubella] Length = 669 Score = 103 bits (258), Expect = 2e-20 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = +2 Query: 2 DFKWSNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKT 166 +FKW+NFTLEEQAKVIVA RSNNE+DASKLKKEFPELLSIKESLIKY FEPNKKT Sbjct: 615 EFKWANFTLEEQAKVIVAPRSNNELDASKLKKEFPELLSIKESLIKYAFEPNKKT 669 >ref|XP_004248232.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Solanum lycopersicum] Length = 674 Score = 103 bits (258), Expect = 2e-20 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +2 Query: 5 FKWSNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKTSA 172 F ++NFT+EEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKTSA Sbjct: 619 FTYANFTVEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKTSA 674 >ref|XP_003546628.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X1 [Glycine max] gi|571520322|ref|XP_006597976.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X2 [Glycine max] gi|571520324|ref|XP_006597977.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X3 [Glycine max] Length = 668 Score = 103 bits (258), Expect = 2e-20 Identities = 51/55 (92%), Positives = 53/55 (96%) Frame = +2 Query: 2 DFKWSNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKT 166 +FKW+NFTLEEQAKVIVA RSNNEMDASKLK EFPELLSIKESLIKYVFEPNKKT Sbjct: 614 NFKWANFTLEEQAKVIVAPRSNNEMDASKLKTEFPELLSIKESLIKYVFEPNKKT 668 >ref|XP_003543185.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X1 [Glycine max] gi|571500835|ref|XP_006594709.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X2 [Glycine max] Length = 669 Score = 103 bits (258), Expect = 2e-20 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = +2 Query: 5 FKWSNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKTS 169 FKW+NF LEEQAKVI+AARSNNEMDASKLK EFPELLSIKESLIKYVFEPNKKT+ Sbjct: 615 FKWANFNLEEQAKVIIAARSNNEMDASKLKNEFPELLSIKESLIKYVFEPNKKTA 669 >gb|EYU26294.1| hypothetical protein MIMGU_mgv1a002474mg [Mimulus guttatus] Length = 669 Score = 103 bits (257), Expect = 2e-20 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = +2 Query: 2 DFKWSNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKTSA 172 DFK+SNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIK+SLIK VFEPN+KT A Sbjct: 612 DFKYSNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKDSLIKIVFEPNRKTPA 668 >ref|XP_006306947.1| hypothetical protein CARUB_v10008513mg [Capsella rubella] gi|482575658|gb|EOA39845.1| hypothetical protein CARUB_v10008513mg [Capsella rubella] Length = 668 Score = 103 bits (257), Expect = 2e-20 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = +2 Query: 5 FKWSNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKT 166 FKWSNFTLEEQAKVIVAARSNNEMD SKL KEFPE+LSIKESLIKYVFEPNK+T Sbjct: 615 FKWSNFTLEEQAKVIVAARSNNEMDGSKLSKEFPEMLSIKESLIKYVFEPNKRT 668 >ref|XP_006649857.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Oryza brachyantha] Length = 673 Score = 103 bits (256), Expect = 3e-20 Identities = 50/57 (87%), Positives = 53/57 (92%) Frame = +2 Query: 2 DFKWSNFTLEEQAKVIVAARSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKTSA 172 DFKW+NFTLEEQAKVIVA RSNNEMDASKLK EFPELLSIK+SLIKYVFEPN+K A Sbjct: 616 DFKWTNFTLEEQAKVIVAPRSNNEMDASKLKSEFPELLSIKDSLIKYVFEPNRKVPA 672