BLASTX nr result
ID: Mentha26_contig00020788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00020788 (465 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36010.1| hypothetical protein MIMGU_mgv1a002796mg [Mimulus... 57 2e-06 ref|XP_002515855.1| fk506 binding protein, putative [Ricinus com... 56 6e-06 >gb|EYU36010.1| hypothetical protein MIMGU_mgv1a002796mg [Mimulus guttatus] Length = 637 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 3 KKTKNFFLGRSGMILAMFMLLLAVILHWFGFVGK 104 +KTKN+ LGR GMILA+ MLL A ILHWFGFVGK Sbjct: 604 RKTKNWLLGRPGMILAIVMLLFAFILHWFGFVGK 637 >ref|XP_002515855.1| fk506 binding protein, putative [Ricinus communis] gi|223545010|gb|EEF46524.1| fk506 binding protein, putative [Ricinus communis] Length = 595 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +3 Query: 3 KKTKNFFLGRSGMILAMFMLLLAVILHWFGFVGK 104 KK KN+ LGRSGMILA+ ML+LA+ILHW G++GK Sbjct: 562 KKAKNWLLGRSGMILAICMLILAMILHWLGYIGK 595