BLASTX nr result
ID: Mentha26_contig00020575
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00020575 (362 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS64483.1| hypothetical protein M569_10301, partial [Genlise... 75 9e-12 gb|EYU42387.1| hypothetical protein MIMGU_mgv1a011121mg [Mimulus... 57 3e-06 >gb|EPS64483.1| hypothetical protein M569_10301, partial [Genlisea aurea] Length = 96 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -3 Query: 270 DALLVIIIPNAGRVVFMDAKKFMQLIEEKKKRVLAKKEAPLKW 142 DA+ VIIIPNAGR V MDAKKF+QL+E+KKKR+LAKKEAPLKW Sbjct: 1 DAIPVIIIPNAGRFVSMDAKKFLQLVEDKKKRILAKKEAPLKW 43 >gb|EYU42387.1| hypothetical protein MIMGU_mgv1a011121mg [Mimulus guttatus] Length = 292 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -3 Query: 222 MDAKKFMQLIEEKKKRVLAKKEAPLKW 142 MDAKKFMQL+EEKKKRVLAKKEAPLKW Sbjct: 1 MDAKKFMQLVEEKKKRVLAKKEAPLKW 27