BLASTX nr result
ID: Mentha26_contig00020568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00020568 (324 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33731.1| hypothetical protein MIMGU_mgv1a009872mg [Mimulus... 113 2e-23 ref|XP_006495199.1| PREDICTED: BTB/POZ domain-containing protein... 111 1e-22 ref|XP_006452707.1| hypothetical protein CICLE_v10008898mg [Citr... 111 1e-22 ref|XP_006452706.1| hypothetical protein CICLE_v10008898mg [Citr... 111 1e-22 ref|XP_006452705.1| hypothetical protein CICLE_v10008898mg [Citr... 111 1e-22 gb|ACL81160.1| BTB/POZ domain-containing protein [Mirabilis jalapa] 106 3e-21 ref|XP_007020379.1| BTB/POZ domain-containing protein [Theobroma... 103 2e-20 ref|XP_006392606.1| hypothetical protein EUTSA_v10011642mg [Eutr... 103 3e-20 ref|XP_006346099.1| PREDICTED: BTB/POZ domain-containing protein... 103 3e-20 ref|XP_006305328.1| hypothetical protein CARUB_v10009707mg [Caps... 103 3e-20 ref|NP_175972.1| BTB/POZ domain-containing protein [Arabidopsis ... 103 3e-20 ref|XP_002276318.1| PREDICTED: BTB/POZ domain-containing protein... 103 3e-20 ref|XP_004244017.1| PREDICTED: BTB/POZ domain-containing protein... 102 4e-20 ref|XP_002299061.1| BTB/POZ domain-containing family protein [Po... 102 4e-20 gb|AGG38123.1| BTB/POZ domain-containing protein [Dimocarpus lon... 102 6e-20 gb|EXB51037.1| BTB/POZ domain-containing protein [Morus notabilis] 101 1e-19 ref|XP_002894527.1| BTB/POZ domain-containing protein [Arabidops... 100 2e-19 gb|EPS72413.1| hypothetical protein M569_02335, partial [Genlise... 100 4e-19 ref|XP_004294912.1| PREDICTED: BTB/POZ domain-containing protein... 100 4e-19 ref|XP_004139768.1| PREDICTED: BTB/POZ domain-containing protein... 99 6e-19 >gb|EYU33731.1| hypothetical protein MIMGU_mgv1a009872mg [Mimulus guttatus] Length = 328 Score = 113 bits (283), Expect = 2e-23 Identities = 53/61 (86%), Positives = 58/61 (95%) Frame = -1 Query: 324 ERLQNASLYQLPQLKSSCMRYLVKFGKVFDIREDFSVFVQCADRELIGEVLNEILAAWKG 145 ERLQNASLYQLP+LKSSCM+YLVKFGK+FDIR+DF+ FV CADRELI EVLNEILAAWKG Sbjct: 268 ERLQNASLYQLPKLKSSCMKYLVKFGKIFDIRDDFNAFVLCADRELISEVLNEILAAWKG 327 Query: 144 F 142 F Sbjct: 328 F 328 >ref|XP_006495199.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Citrus sinensis] Length = 399 Score = 111 bits (277), Expect = 1e-22 Identities = 51/61 (83%), Positives = 57/61 (93%) Frame = -1 Query: 324 ERLQNASLYQLPQLKSSCMRYLVKFGKVFDIREDFSVFVQCADRELIGEVLNEILAAWKG 145 ERLQNA LYQLP+LKSSCMRYLVKFGK+FDIR+DFSVF+QCADRELI EV +E+L AWKG Sbjct: 339 ERLQNAYLYQLPKLKSSCMRYLVKFGKIFDIRDDFSVFLQCADRELIAEVFHEVLGAWKG 398 Query: 144 F 142 F Sbjct: 399 F 399 >ref|XP_006452707.1| hypothetical protein CICLE_v10008898mg [Citrus clementina] gi|568841705|ref|XP_006474798.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Citrus sinensis] gi|557555933|gb|ESR65947.1| hypothetical protein CICLE_v10008898mg [Citrus clementina] Length = 328 Score = 111 bits (277), Expect = 1e-22 Identities = 51/61 (83%), Positives = 57/61 (93%) Frame = -1 Query: 324 ERLQNASLYQLPQLKSSCMRYLVKFGKVFDIREDFSVFVQCADRELIGEVLNEILAAWKG 145 ERLQNA LYQLP+LKSSCMRYLVKFGK+FDIR+DFSVF+QCADRELI EV +E+L AWKG Sbjct: 268 ERLQNAYLYQLPKLKSSCMRYLVKFGKIFDIRDDFSVFLQCADRELIAEVFHEVLGAWKG 327 Query: 144 F 142 F Sbjct: 328 F 328 >ref|XP_006452706.1| hypothetical protein CICLE_v10008898mg [Citrus clementina] gi|557555932|gb|ESR65946.1| hypothetical protein CICLE_v10008898mg [Citrus clementina] Length = 280 Score = 111 bits (277), Expect = 1e-22 Identities = 51/61 (83%), Positives = 57/61 (93%) Frame = -1 Query: 324 ERLQNASLYQLPQLKSSCMRYLVKFGKVFDIREDFSVFVQCADRELIGEVLNEILAAWKG 145 ERLQNA LYQLP+LKSSCMRYLVKFGK+FDIR+DFSVF+QCADRELI EV +E+L AWKG Sbjct: 220 ERLQNAYLYQLPKLKSSCMRYLVKFGKIFDIRDDFSVFLQCADRELIAEVFHEVLGAWKG 279 Query: 144 F 142 F Sbjct: 280 F 280 >ref|XP_006452705.1| hypothetical protein CICLE_v10008898mg [Citrus clementina] gi|557555931|gb|ESR65945.1| hypothetical protein CICLE_v10008898mg [Citrus clementina] Length = 263 Score = 111 bits (277), Expect = 1e-22 Identities = 51/61 (83%), Positives = 57/61 (93%) Frame = -1 Query: 324 ERLQNASLYQLPQLKSSCMRYLVKFGKVFDIREDFSVFVQCADRELIGEVLNEILAAWKG 145 ERLQNA LYQLP+LKSSCMRYLVKFGK+FDIR+DFSVF+QCADRELI EV +E+L AWKG Sbjct: 203 ERLQNAYLYQLPKLKSSCMRYLVKFGKIFDIRDDFSVFLQCADRELIAEVFHEVLGAWKG 262 Query: 144 F 142 F Sbjct: 263 F 263 >gb|ACL81160.1| BTB/POZ domain-containing protein [Mirabilis jalapa] Length = 332 Score = 106 bits (265), Expect = 3e-21 Identities = 48/61 (78%), Positives = 56/61 (91%) Frame = -1 Query: 324 ERLQNASLYQLPQLKSSCMRYLVKFGKVFDIREDFSVFVQCADRELIGEVLNEILAAWKG 145 ERLQ+A+LYQLP+LKSSCMRYLVKFGK+FDIR++FS+F+QCADRELI EV EIL WKG Sbjct: 272 ERLQSAALYQLPELKSSCMRYLVKFGKIFDIRDEFSMFIQCADRELITEVFQEILGTWKG 331 Query: 144 F 142 F Sbjct: 332 F 332 >ref|XP_007020379.1| BTB/POZ domain-containing protein [Theobroma cacao] gi|508720007|gb|EOY11904.1| BTB/POZ domain-containing protein [Theobroma cacao] Length = 355 Score = 103 bits (258), Expect = 2e-20 Identities = 45/61 (73%), Positives = 56/61 (91%) Frame = -1 Query: 324 ERLQNASLYQLPQLKSSCMRYLVKFGKVFDIREDFSVFVQCADRELIGEVLNEILAAWKG 145 ERLQNA+LYQLP+LKSSCMRYLV+FGK++DIR+DF+ F+QCADRELI +V +E+L WKG Sbjct: 295 ERLQNAALYQLPKLKSSCMRYLVRFGKIYDIRDDFNAFLQCADRELIADVFHEVLNTWKG 354 Query: 144 F 142 F Sbjct: 355 F 355 >ref|XP_006392606.1| hypothetical protein EUTSA_v10011642mg [Eutrema salsugineum] gi|557089184|gb|ESQ29892.1| hypothetical protein EUTSA_v10011642mg [Eutrema salsugineum] Length = 329 Score = 103 bits (257), Expect = 3e-20 Identities = 44/61 (72%), Positives = 57/61 (93%) Frame = -1 Query: 324 ERLQNASLYQLPQLKSSCMRYLVKFGKVFDIREDFSVFVQCADRELIGEVLNEILAAWKG 145 ERLQNA LYQLP+LK+SCMRYLVKFGK+F+IR++F++F+QCADR+LI EV +E+L+ WKG Sbjct: 269 ERLQNAYLYQLPELKASCMRYLVKFGKIFEIRDEFNIFMQCADRDLISEVFHEVLSTWKG 328 Query: 144 F 142 F Sbjct: 329 F 329 >ref|XP_006346099.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Solanum tuberosum] Length = 328 Score = 103 bits (256), Expect = 3e-20 Identities = 46/61 (75%), Positives = 55/61 (90%) Frame = -1 Query: 324 ERLQNASLYQLPQLKSSCMRYLVKFGKVFDIREDFSVFVQCADRELIGEVLNEILAAWKG 145 ERLQ ASLYQLP LK+ CMRYLV+FGK+FDIR+DFS F+Q ADRE+IGE+ +E+LAAWKG Sbjct: 268 ERLQTASLYQLPNLKACCMRYLVRFGKIFDIRDDFSAFLQHADREIIGEIFHEVLAAWKG 327 Query: 144 F 142 F Sbjct: 328 F 328 >ref|XP_006305328.1| hypothetical protein CARUB_v10009707mg [Capsella rubella] gi|482574039|gb|EOA38226.1| hypothetical protein CARUB_v10009707mg [Capsella rubella] Length = 329 Score = 103 bits (256), Expect = 3e-20 Identities = 45/61 (73%), Positives = 55/61 (90%) Frame = -1 Query: 324 ERLQNASLYQLPQLKSSCMRYLVKFGKVFDIREDFSVFVQCADRELIGEVLNEILAAWKG 145 ERLQNA LYQLP+LK+SCMRYLVKFGKVF+IR++F++F+QCADR+LI EV E+L WKG Sbjct: 269 ERLQNAYLYQLPELKASCMRYLVKFGKVFEIRDEFNIFMQCADRDLISEVFQEVLGTWKG 328 Query: 144 F 142 F Sbjct: 329 F 329 >ref|NP_175972.1| BTB/POZ domain-containing protein [Arabidopsis thaliana] gi|75271590|sp|Q680K8.1|Y1576_ARATH RecName: Full=BTB/POZ domain-containing protein At1g55760 gi|51969392|dbj|BAD43388.1| unknown protein [Arabidopsis thaliana] gi|51969860|dbj|BAD43622.1| unknown protein [Arabidopsis thaliana] gi|63147370|gb|AAY34158.1| At1g55760 [Arabidopsis thaliana] gi|332195173|gb|AEE33294.1| BTB/POZ domain-containing protein [Arabidopsis thaliana] Length = 329 Score = 103 bits (256), Expect = 3e-20 Identities = 43/61 (70%), Positives = 57/61 (93%) Frame = -1 Query: 324 ERLQNASLYQLPQLKSSCMRYLVKFGKVFDIREDFSVFVQCADRELIGEVLNEILAAWKG 145 ERLQNA LYQLP+LK+SCMRYLVKFGK+F+IR++F++F+QCADR+LI E+ +E+L+ WKG Sbjct: 269 ERLQNAYLYQLPELKASCMRYLVKFGKIFEIRDEFNIFMQCADRDLISEIFHEVLSTWKG 328 Query: 144 F 142 F Sbjct: 329 F 329 >ref|XP_002276318.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 [Vitis vinifera] Length = 328 Score = 103 bits (256), Expect = 3e-20 Identities = 45/61 (73%), Positives = 56/61 (91%) Frame = -1 Query: 324 ERLQNASLYQLPQLKSSCMRYLVKFGKVFDIREDFSVFVQCADRELIGEVLNEILAAWKG 145 ERLQNASLYQL +LK++C+RYLVKFGK+FDIR+DF+ F+QCADR+LI EV +E+L AWKG Sbjct: 268 ERLQNASLYQLSKLKTACLRYLVKFGKIFDIRDDFNAFLQCADRDLIAEVFHEVLTAWKG 327 Query: 144 F 142 F Sbjct: 328 F 328 >ref|XP_004244017.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Solanum lycopersicum] Length = 328 Score = 102 bits (255), Expect = 4e-20 Identities = 46/61 (75%), Positives = 55/61 (90%) Frame = -1 Query: 324 ERLQNASLYQLPQLKSSCMRYLVKFGKVFDIREDFSVFVQCADRELIGEVLNEILAAWKG 145 ERLQ ASLYQLP LK+ CMRYLV+FGK+FDIR+DF+ F+Q ADRE+IGE+ +EILAAWKG Sbjct: 268 ERLQTASLYQLPNLKACCMRYLVRFGKIFDIRDDFTAFLQYADREIIGEIFHEILAAWKG 327 Query: 144 F 142 F Sbjct: 328 F 328 >ref|XP_002299061.1| BTB/POZ domain-containing family protein [Populus trichocarpa] gi|222846319|gb|EEE83866.1| BTB/POZ domain-containing family protein [Populus trichocarpa] Length = 330 Score = 102 bits (255), Expect = 4e-20 Identities = 45/61 (73%), Positives = 57/61 (93%) Frame = -1 Query: 324 ERLQNASLYQLPQLKSSCMRYLVKFGKVFDIREDFSVFVQCADRELIGEVLNEILAAWKG 145 ERLQ+ASLYQLP+LK+SC+RYLVKFGK+FDIR+DF+ F+QCADR+LI EV +E+L +WKG Sbjct: 270 ERLQSASLYQLPKLKTSCLRYLVKFGKIFDIRDDFNSFLQCADRDLIAEVFHEVLNSWKG 329 Query: 144 F 142 F Sbjct: 330 F 330 >gb|AGG38123.1| BTB/POZ domain-containing protein [Dimocarpus longan] Length = 328 Score = 102 bits (254), Expect = 6e-20 Identities = 46/60 (76%), Positives = 55/60 (91%) Frame = -1 Query: 321 RLQNASLYQLPQLKSSCMRYLVKFGKVFDIREDFSVFVQCADRELIGEVLNEILAAWKGF 142 RLQNASLYQLP+LKSSCMRYLVKFGK+FDI++DF+ F+Q ADRELI E+ +E+L AWKGF Sbjct: 269 RLQNASLYQLPKLKSSCMRYLVKFGKIFDIQDDFNAFLQNADRELISEIFHEVLGAWKGF 328 >gb|EXB51037.1| BTB/POZ domain-containing protein [Morus notabilis] Length = 328 Score = 101 bits (251), Expect = 1e-19 Identities = 45/61 (73%), Positives = 55/61 (90%) Frame = -1 Query: 324 ERLQNASLYQLPQLKSSCMRYLVKFGKVFDIREDFSVFVQCADRELIGEVLNEILAAWKG 145 +RLQNASLY LP+LK+SCMRYLVKFGK+FDIREDF+ F+ ADRELI E+ +E+L+AWKG Sbjct: 268 DRLQNASLYNLPKLKTSCMRYLVKFGKIFDIREDFNAFLLSADRELIAEIFHEVLSAWKG 327 Query: 144 F 142 F Sbjct: 328 F 328 >ref|XP_002894527.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297340369|gb|EFH70786.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 329 Score = 100 bits (249), Expect = 2e-19 Identities = 43/61 (70%), Positives = 56/61 (91%) Frame = -1 Query: 324 ERLQNASLYQLPQLKSSCMRYLVKFGKVFDIREDFSVFVQCADRELIGEVLNEILAAWKG 145 ERLQNA LYQLP+LK+SCMRYLVKFGK+F+I ++F++F+QCADR+LI EV +E+L+ WKG Sbjct: 269 ERLQNAYLYQLPELKASCMRYLVKFGKIFEICDEFNIFMQCADRDLISEVFHEVLSTWKG 328 Query: 144 F 142 F Sbjct: 329 F 329 >gb|EPS72413.1| hypothetical protein M569_02335, partial [Genlisea aurea] Length = 328 Score = 99.8 bits (247), Expect = 4e-19 Identities = 46/61 (75%), Positives = 53/61 (86%) Frame = -1 Query: 324 ERLQNASLYQLPQLKSSCMRYLVKFGKVFDIREDFSVFVQCADRELIGEVLNEILAAWKG 145 ERLQNASLY LP+LK C+RYLV+FGK+FDIR+DF F+Q ADRELI EV+NEIL AWKG Sbjct: 268 ERLQNASLYGLPKLKEGCIRYLVRFGKIFDIRDDFGSFLQSADRELIAEVVNEILIAWKG 327 Query: 144 F 142 F Sbjct: 328 F 328 >ref|XP_004294912.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Fragaria vesca subsp. vesca] Length = 328 Score = 99.8 bits (247), Expect = 4e-19 Identities = 44/61 (72%), Positives = 55/61 (90%) Frame = -1 Query: 324 ERLQNASLYQLPQLKSSCMRYLVKFGKVFDIREDFSVFVQCADRELIGEVLNEILAAWKG 145 +RLQNASLY+L +LK+SCMRYLVKFGK+FDIR+DF+ F+ CADRELI E+ +E+L AWKG Sbjct: 268 DRLQNASLYELLRLKTSCMRYLVKFGKIFDIRDDFNAFLLCADRELIAEIFHEVLNAWKG 327 Query: 144 F 142 F Sbjct: 328 F 328 >ref|XP_004139768.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Cucumis sativus] gi|449529700|ref|XP_004171836.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Cucumis sativus] Length = 327 Score = 99.0 bits (245), Expect = 6e-19 Identities = 44/61 (72%), Positives = 56/61 (91%) Frame = -1 Query: 324 ERLQNASLYQLPQLKSSCMRYLVKFGKVFDIREDFSVFVQCADRELIGEVLNEILAAWKG 145 ERLQNASLYQLP+LK+SCM+YLVKFGK+ DIR++F++F+Q ADR+LI E+ +EIL AWKG Sbjct: 267 ERLQNASLYQLPKLKTSCMQYLVKFGKILDIRDEFNIFLQNADRDLIAEIFHEILNAWKG 326 Query: 144 F 142 F Sbjct: 327 F 327