BLASTX nr result
ID: Mentha26_contig00020556
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00020556 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45002.1| hypothetical protein MIMGU_mgv1a0043822mg [Mimulu... 64 3e-08 >gb|EYU45002.1| hypothetical protein MIMGU_mgv1a0043822mg [Mimulus guttatus] Length = 530 Score = 63.5 bits (153), Expect = 3e-08 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 2/73 (2%) Frame = +2 Query: 140 LHL--PFKLSPTRHTTARSHFHIPTTRTFSWPGFTRRNLRVPHLLHSSAQQFPTDDATSS 313 LHL P PTR ++ FHIPT TFS PG R+L+V LLHSS ++ +DD ++ Sbjct: 8 LHLKPPPNPYPTRILSSL-RFHIPTELTFSGPGLPNRHLQVFPLLHSSPLKYSSDDNVTA 66 Query: 314 AAEDFKVELGRLL 352 AEDF VELGRLL Sbjct: 67 TAEDFNVELGRLL 79