BLASTX nr result
ID: Mentha26_contig00020488
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00020488 (594 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276733.1| PREDICTED: uncharacterized protein LOC100266... 61 3e-07 >ref|XP_002276733.1| PREDICTED: uncharacterized protein LOC100266910 [Vitis vinifera] Length = 363 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/63 (47%), Positives = 42/63 (66%) Frame = +3 Query: 6 FDINVVERNEGIEVGYERNYMSLFFLLQAFDPAGSVGPDRGARLQERDSNSNVALDRGSL 185 FD + VERNEG EVG++ N +++F LL AF PAG++G +R R ER ALD G++ Sbjct: 247 FDADAVERNEGFEVGFDSNLVNVFLLLHAFGPAGNIGLNRRLRRSERGLGR--ALDEGAV 304 Query: 186 RLH 194 +H Sbjct: 305 GIH 307