BLASTX nr result
ID: Mentha26_contig00020319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00020319 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44874.1| hypothetical protein MIMGU_mgv1a013007mg [Mimulus... 91 2e-16 ref|XP_007220532.1| hypothetical protein PRUPE_ppa010412mg [Prun... 80 4e-13 gb|AAK15090.1|AF240007_1 cystatin [Sesamum indicum] 80 4e-13 ref|XP_004165517.1| PREDICTED: cysteine proteinase inhibitor 12-... 79 7e-13 ref|XP_004147084.1| PREDICTED: cysteine proteinase inhibitor 12-... 79 7e-13 ref|XP_002303955.1| cysteine proteinase inhibitor [Populus trich... 79 7e-13 ref|XP_004307210.1| PREDICTED: cysteine proteinase inhibitor 12-... 75 7e-12 ref|XP_004307209.1| PREDICTED: cysteine proteinase inhibitor 12-... 75 7e-12 gb|AHA85335.1| cysteine protease inhibitor [Curcuma longa] 75 9e-12 ref|XP_002525552.1| cysteine protease inhibitor, putative [Ricin... 75 9e-12 gb|AAO19652.1| cysteine protease inhibitor cystatin [Malus domes... 75 9e-12 emb|CAA89697.1| cysteine proteinase inhibitor [Ricinus communis] 75 9e-12 gb|EXB62705.1| Cysteine proteinase inhibitor 12 [Morus notabilis] 75 1e-11 emb|CAH60163.1| cystatin CPI-1 [Fragaria x ananassa] gi|70907503... 74 2e-11 ref|NP_001237734.1| cysteine proteinase inhibitor precursor [Gly... 73 4e-11 ref|XP_007010774.1| Cysteine proteinase inhibitor 12 [Theobroma ... 73 4e-11 gb|ACU24145.1| unknown [Glycine max] 73 4e-11 ref|XP_003628013.1| Cysteine proteinase inhibitor [Medicago trun... 72 6e-11 gb|ABB89766.1| At3g12490-like protein [Boechera stricta] 72 6e-11 gb|AAU81597.1| cysteine proteinase inhibitor [Petunia x hybrida] 72 6e-11 >gb|EYU44874.1| hypothetical protein MIMGU_mgv1a013007mg [Mimulus guttatus] Length = 233 Score = 90.5 bits (223), Expect = 2e-16 Identities = 45/51 (88%), Positives = 48/51 (94%), Gaps = 1/51 (1%) Frame = +3 Query: 3 EIVHANAEVVESSAKFDMLLKVKRGG-KEEKFKVEVHRNNDGGFQLNKMDA 152 E+VHANAEVVES AKFDMLLKVKRGG KEEKFKVEVH+N+DGGF LNKMDA Sbjct: 179 EVVHANAEVVESCAKFDMLLKVKRGGGKEEKFKVEVHKNSDGGFHLNKMDA 229 >ref|XP_007220532.1| hypothetical protein PRUPE_ppa010412mg [Prunus persica] gi|462416994|gb|EMJ21731.1| hypothetical protein PRUPE_ppa010412mg [Prunus persica] Length = 250 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/50 (72%), Positives = 45/50 (90%) Frame = +3 Query: 3 EIVHANAEVVESSAKFDMLLKVKRGGKEEKFKVEVHRNNDGGFQLNKMDA 152 E+VHA AEV+E AKF+MLLK+KRG KEEKFKVEVH+NN+G F+LN+M+A Sbjct: 198 EVVHAKAEVIEEHAKFNMLLKLKRGDKEEKFKVEVHKNNEGTFKLNQMEA 247 >gb|AAK15090.1|AF240007_1 cystatin [Sesamum indicum] Length = 199 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/50 (76%), Positives = 46/50 (92%), Gaps = 1/50 (2%) Frame = +3 Query: 3 EIVHANAEVVESSAKFDMLLKVKRGGKEEKFKVEVHRN-NDGGFQLNKMD 149 E+VHANAEVV++SAKFDMLLKVKRGGKEEK+KVEVH++ +GGF L K+D Sbjct: 146 EVVHANAEVVDTSAKFDMLLKVKRGGKEEKYKVEVHKSTEEGGFNLKKVD 195 >ref|XP_004165517.1| PREDICTED: cysteine proteinase inhibitor 12-like [Cucumis sativus] Length = 202 Score = 79.0 bits (193), Expect = 7e-13 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = +3 Query: 3 EIVHANAEVVESSAKFDMLLKVKRGGKEEKFKVEVHRNNDGGFQLNKM 146 EI+HA AEV+E +AKFD+LLK+KRG KEEKFKVEVH+NN+G F LN+M Sbjct: 150 EIIHAKAEVIEDAAKFDLLLKLKRGSKEEKFKVEVHKNNEGNFLLNQM 197 >ref|XP_004147084.1| PREDICTED: cysteine proteinase inhibitor 12-like [Cucumis sativus] Length = 249 Score = 79.0 bits (193), Expect = 7e-13 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = +3 Query: 3 EIVHANAEVVESSAKFDMLLKVKRGGKEEKFKVEVHRNNDGGFQLNKM 146 EI+HA AEV+E +AKFD+LLK+KRG KEEKFKVEVH+NN+G F LN+M Sbjct: 197 EIIHAKAEVIEDAAKFDLLLKLKRGSKEEKFKVEVHKNNEGNFLLNQM 244 >ref|XP_002303955.1| cysteine proteinase inhibitor [Populus trichocarpa] gi|222841387|gb|EEE78934.1| cysteine proteinase inhibitor [Populus trichocarpa] Length = 235 Score = 79.0 bits (193), Expect = 7e-13 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = +3 Query: 3 EIVHANAEVVESSAKFDMLLKVKRGGKEEKFKVEVHRNNDGGFQLNKMD 149 E+VHANAEVV+ SAKFDMLLKVKRG EEKFKV VH+NN+G + LN+M+ Sbjct: 184 EVVHANAEVVDDSAKFDMLLKVKRGSTEEKFKVLVHKNNEGNYHLNQME 232 >ref|XP_004307210.1| PREDICTED: cysteine proteinase inhibitor 12-like isoform 2 [Fragaria vesca subsp. vesca] Length = 230 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/49 (67%), Positives = 43/49 (87%) Frame = +3 Query: 3 EIVHANAEVVESSAKFDMLLKVKRGGKEEKFKVEVHRNNDGGFQLNKMD 149 E+VHA AEV+E AKF+MLLK+KRG KEEK+KVEVH+NN+G + LN+M+ Sbjct: 179 EVVHAKAEVMEEHAKFNMLLKLKRGDKEEKYKVEVHKNNEGAYNLNQME 227 >ref|XP_004307209.1| PREDICTED: cysteine proteinase inhibitor 12-like isoform 1 [Fragaria vesca subsp. vesca] Length = 235 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/49 (67%), Positives = 43/49 (87%) Frame = +3 Query: 3 EIVHANAEVVESSAKFDMLLKVKRGGKEEKFKVEVHRNNDGGFQLNKMD 149 E+VHA AEV+E AKF+MLLK+KRG KEEK+KVEVH+NN+G + LN+M+ Sbjct: 184 EVVHAKAEVMEEHAKFNMLLKLKRGDKEEKYKVEVHKNNEGAYNLNQME 232 >gb|AHA85335.1| cysteine protease inhibitor [Curcuma longa] Length = 228 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = +3 Query: 3 EIVHANAEVVESSAKFDMLLKVKRGGKEEKFKVEVHRNNDGGFQLNKM 146 E++HA AEV+E +AKFDMLLKVKRG KEEKFK EVH+N +G F LN+M Sbjct: 177 EVLHAKAEVIEETAKFDMLLKVKRGSKEEKFKAEVHKNLEGNFLLNQM 224 >ref|XP_002525552.1| cysteine protease inhibitor, putative [Ricinus communis] gi|223535131|gb|EEF36811.1| cysteine protease inhibitor, putative [Ricinus communis] Length = 238 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = +3 Query: 3 EIVHANAEVVESSAKFDMLLKVKRGGKEEKFKVEVHRNNDGGFQLNKMD 149 EIVHA A+VV+ AKFDM+LKVKRG EEKFKVEVH+NN+G F LN+M+ Sbjct: 187 EIVHAKAQVVDDFAKFDMILKVKRGTSEEKFKVEVHKNNEGTFLLNQME 235 >gb|AAO19652.1| cysteine protease inhibitor cystatin [Malus domestica] Length = 246 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/50 (70%), Positives = 41/50 (82%) Frame = +3 Query: 3 EIVHANAEVVESSAKFDMLLKVKRGGKEEKFKVEVHRNNDGGFQLNKMDA 152 E+VHA AEV E AKF+MLLKVKRG KEEKFK EVH+N +G F LN+M+A Sbjct: 194 EVVHAQAEVAEEHAKFNMLLKVKRGSKEEKFKAEVHKNMEGTFSLNQMEA 243 >emb|CAA89697.1| cysteine proteinase inhibitor [Ricinus communis] Length = 209 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = +3 Query: 3 EIVHANAEVVESSAKFDMLLKVKRGGKEEKFKVEVHRNNDGGFQLNKMD 149 EIVHA A+VV+ AKFDM+LKVKRG EEKFKVEVH+NN+G F LN+M+ Sbjct: 158 EIVHAKAQVVDDFAKFDMILKVKRGTSEEKFKVEVHKNNEGTFLLNQME 206 >gb|EXB62705.1| Cysteine proteinase inhibitor 12 [Morus notabilis] Length = 239 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/49 (65%), Positives = 44/49 (89%) Frame = +3 Query: 3 EIVHANAEVVESSAKFDMLLKVKRGGKEEKFKVEVHRNNDGGFQLNKMD 149 E+VHA AEV+++SAKFDM+LKVKRG KEEK+K EVH+N++G F LN+++ Sbjct: 187 EVVHAKAEVIDNSAKFDMILKVKRGTKEEKYKAEVHKNSEGTFHLNQIE 235 >emb|CAH60163.1| cystatin CPI-1 [Fragaria x ananassa] gi|70907503|emb|CAH89260.1| Fa-CPI1 protein [Fragaria x ananassa] Length = 235 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/49 (65%), Positives = 43/49 (87%) Frame = +3 Query: 3 EIVHANAEVVESSAKFDMLLKVKRGGKEEKFKVEVHRNNDGGFQLNKMD 149 E+VHA +EV+E AKF+MLLK+KRG KEEK+KVEVH+NN+G + LN+M+ Sbjct: 184 EVVHAKSEVMEEHAKFNMLLKLKRGDKEEKYKVEVHKNNEGAYNLNQME 232 >ref|NP_001237734.1| cysteine proteinase inhibitor precursor [Glycine max] gi|1944319|dbj|BAA19608.1| cysteine proteinase inhibitor [Glycine max] gi|1944342|dbj|BAA19610.1| cysteine proteinase inhibitor [Glycine max] Length = 245 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +3 Query: 3 EIVHANAEVVESSAKFDMLLKVKRGGKEEKFKVEVHRNNDGGFQLNKMD 149 E+ A AEV++ AKF++LLKVKRG KEEKFKVEVH+NN GGF LN+M+ Sbjct: 193 EVADAKAEVIDDFAKFNLLLKVKRGQKEEKFKVEVHKNNQGGFHLNQME 241 >ref|XP_007010774.1| Cysteine proteinase inhibitor 12 [Theobroma cacao] gi|508727687|gb|EOY19584.1| Cysteine proteinase inhibitor 12 [Theobroma cacao] Length = 239 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = +3 Query: 3 EIVHANAEVVESSAKFDMLLKVKRGGKEEKFKVEVHRNNDGGFQLNKMD 149 EIVHA AEV+E AK DMLLKVKRG KEEKFKVEVH ++G F LN+M+ Sbjct: 187 EIVHAKAEVLEDFAKLDMLLKVKRGDKEEKFKVEVHHKSEGTFHLNRME 235 >gb|ACU24145.1| unknown [Glycine max] Length = 245 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +3 Query: 3 EIVHANAEVVESSAKFDMLLKVKRGGKEEKFKVEVHRNNDGGFQLNKMD 149 E+ A AEV++ AKF++LLKVKRG KEEKFKVEVH+NN GGF LN+M+ Sbjct: 193 EVADAKAEVIDDFAKFNLLLKVKRGQKEEKFKVEVHKNNQGGFHLNQME 241 >ref|XP_003628013.1| Cysteine proteinase inhibitor [Medicago truncatula] gi|355522035|gb|AET02489.1| Cysteine proteinase inhibitor [Medicago truncatula] Length = 241 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/50 (64%), Positives = 43/50 (86%) Frame = +3 Query: 3 EIVHANAEVVESSAKFDMLLKVKRGGKEEKFKVEVHRNNDGGFQLNKMDA 152 E+ A AEV++ +AKF++LLKVKRG KEEKFKVEVH+N++G F LN+M+A Sbjct: 189 EVTDAKAEVIDDTAKFNLLLKVKRGQKEEKFKVEVHKNSEGNFHLNQMEA 238 >gb|ABB89766.1| At3g12490-like protein [Boechera stricta] Length = 231 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +3 Query: 3 EIVHANAEVVESSAKFDMLLKVKRGGKEEKFKVEVHRNNDGGFQLNKMD 149 E+VHANAEV +AKF+MLLK+KRG KEEKFKVEVH+N++G LN M+ Sbjct: 179 EVVHANAEVTGETAKFNMLLKLKRGEKEEKFKVEVHKNHEGALHLNHME 227 >gb|AAU81597.1| cysteine proteinase inhibitor [Petunia x hybrida] Length = 252 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = +3 Query: 3 EIVHANAEVVESSAKFDMLLKVKRGGKEEKFKVEVHRNNDGGFQLNKMD 149 EIVHANAE++E S K ML+K RGGKEEKFKV+VH +N+G F LN M+ Sbjct: 200 EIVHANAEMIEDSTKLHMLIKTSRGGKEEKFKVQVHHSNEGAFHLNHME 248