BLASTX nr result
ID: Mentha26_contig00020066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00020066 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22724.1| hypothetical protein MIMGU_mgv1a001834mg [Mimulus... 75 1e-11 >gb|EYU22724.1| hypothetical protein MIMGU_mgv1a001834mg [Mimulus guttatus] Length = 752 Score = 74.7 bits (182), Expect = 1e-11 Identities = 40/63 (63%), Positives = 49/63 (77%), Gaps = 2/63 (3%) Frame = -3 Query: 184 DNEKADVGSVEEPGQPNAESEEEPSLVPREGDVPVDSSER--GSDTQILSRKMEVPNDKV 11 +N+K D+GS ++ GQ N E EE S PREGDVPV S+E GSDT++LSRKMEVP+DKV Sbjct: 168 ENDKIDIGSTDKLGQQNTEVEES-SERPREGDVPVPSAETQLGSDTEVLSRKMEVPSDKV 226 Query: 10 GVL 2 GVL Sbjct: 227 GVL 229