BLASTX nr result
ID: Mentha26_contig00019386
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00019386 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32456.1| hypothetical protein MIMGU_mgv1a012592mg [Mimulus... 108 1e-21 ref|XP_002307476.2| hypothetical protein POPTR_0005s20970g, part... 101 9e-20 ref|XP_002526178.1| conserved hypothetical protein [Ricinus comm... 101 9e-20 ref|XP_002265836.1| PREDICTED: bidirectional sugar transporter S... 100 2e-19 emb|CAN59909.1| hypothetical protein VITISV_037479 [Vitis vinifera] 100 2e-19 ref|XP_002300945.1| nodulin MtN3 family protein [Populus trichoc... 97 2e-18 ref|XP_004150723.1| PREDICTED: bidirectional sugar transporter S... 96 5e-18 ref|XP_006472909.1| PREDICTED: bidirectional sugar transporter S... 96 7e-18 ref|XP_006472908.1| PREDICTED: bidirectional sugar transporter S... 96 7e-18 ref|XP_006434360.1| hypothetical protein CICLE_v10002276mg [Citr... 96 7e-18 ref|XP_006434359.1| hypothetical protein CICLE_v10002276mg [Citr... 96 7e-18 gb|EPS69723.1| hypothetical protein M569_05042 [Genlisea aurea] 96 7e-18 ref|XP_006416299.1| hypothetical protein EUTSA_v10008590mg [Eutr... 95 1e-17 ref|XP_006305555.1| hypothetical protein CARUB_v10010111mg [Caps... 95 1e-17 ref|XP_004290589.1| PREDICTED: bidirectional sugar transporter S... 95 1e-17 gb|AAF87899.1|AC015447_9 Unknown protein [Arabidopsis thaliana] 95 1e-17 ref|NP_564140.1| bidirectional sugar transporter SWEET1 [Arabido... 95 1e-17 ref|XP_002893163.1| nodulin MtN3 family protein [Arabidopsis lyr... 95 1e-17 ref|XP_004498378.1| PREDICTED: bidirectional sugar transporter S... 94 2e-17 ref|XP_006356306.1| PREDICTED: bidirectional sugar transporter S... 94 3e-17 >gb|EYU32456.1| hypothetical protein MIMGU_mgv1a012592mg [Mimulus guttatus] Length = 245 Score = 108 bits (269), Expect = 1e-21 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = +3 Query: 3 FFLSLFVFLCGTSWFIFGLLGKDPFVAIPNGFGCGLGAVQLILYAIYRNNK 155 FFLSLFVFLCGTSWF+FGLLGKDPFVAIPNGFGCGLGAVQLILYAIYR NK Sbjct: 164 FFLSLFVFLCGTSWFVFGLLGKDPFVAIPNGFGCGLGAVQLILYAIYRKNK 214 >ref|XP_002307476.2| hypothetical protein POPTR_0005s20970g, partial [Populus trichocarpa] gi|550339424|gb|EEE94472.2| hypothetical protein POPTR_0005s20970g, partial [Populus trichocarpa] Length = 294 Score = 101 bits (252), Expect = 9e-20 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = +3 Query: 3 FFLSLFVFLCGTSWFIFGLLGKDPFVAIPNGFGCGLGAVQLILYAIYRNNK 155 FFLSLFVFLCGTSWF++GLLG+DPFVA+PNG GCGLGA+QLILY IYRNNK Sbjct: 209 FFLSLFVFLCGTSWFVYGLLGRDPFVAVPNGVGCGLGALQLILYFIYRNNK 259 >ref|XP_002526178.1| conserved hypothetical protein [Ricinus communis] gi|223534555|gb|EEF36254.1| conserved hypothetical protein [Ricinus communis] Length = 248 Score = 101 bits (252), Expect = 9e-20 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = +3 Query: 3 FFLSLFVFLCGTSWFIFGLLGKDPFVAIPNGFGCGLGAVQLILYAIYRNNK 155 FFLSLFVFLCGTSWFI+GLLG+DPFVAIPNGFGCGLG +QLILY IYRN+K Sbjct: 163 FFLSLFVFLCGTSWFIYGLLGRDPFVAIPNGFGCGLGTLQLILYFIYRNSK 213 >ref|XP_002265836.1| PREDICTED: bidirectional sugar transporter SWEET1 [Vitis vinifera] gi|302142751|emb|CBI19954.3| unnamed protein product [Vitis vinifera] Length = 248 Score = 100 bits (249), Expect = 2e-19 Identities = 44/47 (93%), Positives = 47/47 (100%) Frame = +3 Query: 3 FFLSLFVFLCGTSWFIFGLLGKDPFVAIPNGFGCGLGAVQLILYAIY 143 FFLSLFVFLCGTSWF+FGLLGKDPFVA+PNGFGCGLGA+QLILYAIY Sbjct: 166 FFLSLFVFLCGTSWFVFGLLGKDPFVAVPNGFGCGLGAMQLILYAIY 212 >emb|CAN59909.1| hypothetical protein VITISV_037479 [Vitis vinifera] Length = 249 Score = 100 bits (249), Expect = 2e-19 Identities = 44/47 (93%), Positives = 47/47 (100%) Frame = +3 Query: 3 FFLSLFVFLCGTSWFIFGLLGKDPFVAIPNGFGCGLGAVQLILYAIY 143 FFLSLFVFLCGTSWF+FGLLGKDPFVA+PNGFGCGLGA+QLILYAIY Sbjct: 167 FFLSLFVFLCGTSWFVFGLLGKDPFVAVPNGFGCGLGAMQLILYAIY 213 >ref|XP_002300945.1| nodulin MtN3 family protein [Populus trichocarpa] gi|566156716|ref|XP_002300944.2| nodulin MtN3 family protein [Populus trichocarpa] gi|222842671|gb|EEE80218.1| nodulin MtN3 family protein [Populus trichocarpa] gi|550344470|gb|EEE80217.2| nodulin MtN3 family protein [Populus trichocarpa] Length = 250 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = +3 Query: 3 FFLSLFVFLCGTSWFIFGLLGKDPFVAIPNGFGCGLGAVQLILYAIYRNNK 155 FFLSLFVFLCGTSWF+FGLLG D FVA+PNG GCGLGA+QLILY IYRNNK Sbjct: 163 FFLSLFVFLCGTSWFVFGLLGGDLFVAVPNGVGCGLGALQLILYFIYRNNK 213 >ref|XP_004150723.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Cucumis sativus] gi|449521263|ref|XP_004167649.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Cucumis sativus] Length = 252 Score = 95.9 bits (237), Expect = 5e-18 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = +3 Query: 3 FFLSLFVFLCGTSWFIFGLLGKDPFVAIPNGFGCGLGAVQLILYAIYR 146 F LSLFVFLCGTSWFI+GLLG+DPFVA+PNGFGCGLGA+QLILY IYR Sbjct: 163 FLLSLFVFLCGTSWFIYGLLGRDPFVAVPNGFGCGLGALQLILYFIYR 210 >ref|XP_006472909.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform X2 [Citrus sinensis] Length = 204 Score = 95.5 bits (236), Expect = 7e-18 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = +3 Query: 3 FFLSLFVFLCGTSWFIFGLLGKDPFVAIPNGFGCGLGAVQLILYAIY 143 FFLSLFVFLCGTSWF+FGLLG+DPFVA+PNGFGCGLG +QLILY IY Sbjct: 118 FFLSLFVFLCGTSWFVFGLLGRDPFVAVPNGFGCGLGTMQLILYFIY 164 >ref|XP_006472908.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform X1 [Citrus sinensis] Length = 249 Score = 95.5 bits (236), Expect = 7e-18 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = +3 Query: 3 FFLSLFVFLCGTSWFIFGLLGKDPFVAIPNGFGCGLGAVQLILYAIY 143 FFLSLFVFLCGTSWF+FGLLG+DPFVA+PNGFGCGLG +QLILY IY Sbjct: 163 FFLSLFVFLCGTSWFVFGLLGRDPFVAVPNGFGCGLGTMQLILYFIY 209 >ref|XP_006434360.1| hypothetical protein CICLE_v10002276mg [Citrus clementina] gi|557536482|gb|ESR47600.1| hypothetical protein CICLE_v10002276mg [Citrus clementina] Length = 204 Score = 95.5 bits (236), Expect = 7e-18 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = +3 Query: 3 FFLSLFVFLCGTSWFIFGLLGKDPFVAIPNGFGCGLGAVQLILYAIY 143 FFLSLFVFLCGTSWF+FGLLG+DPFVA+PNGFGCGLG +QLILY IY Sbjct: 118 FFLSLFVFLCGTSWFVFGLLGRDPFVAVPNGFGCGLGTMQLILYFIY 164 >ref|XP_006434359.1| hypothetical protein CICLE_v10002276mg [Citrus clementina] gi|557536481|gb|ESR47599.1| hypothetical protein CICLE_v10002276mg [Citrus clementina] Length = 249 Score = 95.5 bits (236), Expect = 7e-18 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = +3 Query: 3 FFLSLFVFLCGTSWFIFGLLGKDPFVAIPNGFGCGLGAVQLILYAIY 143 FFLSLFVFLCGTSWF+FGLLG+DPFVA+PNGFGCGLG +QLILY IY Sbjct: 163 FFLSLFVFLCGTSWFVFGLLGRDPFVAVPNGFGCGLGTMQLILYFIY 209 >gb|EPS69723.1| hypothetical protein M569_05042 [Genlisea aurea] Length = 240 Score = 95.5 bits (236), Expect = 7e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = +3 Query: 3 FFLSLFVFLCGTSWFIFGLLGKDPFVAIPNGFGCGLGAVQLILYAIY 143 FFLSLF FLCGTSWF+FGLLGKDPF+AIPNGFG GLGAVQLI+YAIY Sbjct: 165 FFLSLFAFLCGTSWFVFGLLGKDPFIAIPNGFGSGLGAVQLIMYAIY 211 >ref|XP_006416299.1| hypothetical protein EUTSA_v10008590mg [Eutrema salsugineum] gi|557094070|gb|ESQ34652.1| hypothetical protein EUTSA_v10008590mg [Eutrema salsugineum] Length = 247 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +3 Query: 3 FFLSLFVFLCGTSWFIFGLLGKDPFVAIPNGFGCGLGAVQLILYAIYRNNK 155 FFLSLFVFLCGTSWF++GL+G+DPFVAIPNGFGC LG +QLILY IY NK Sbjct: 163 FFLSLFVFLCGTSWFVYGLIGRDPFVAIPNGFGCALGTLQLILYFIYCGNK 213 >ref|XP_006305555.1| hypothetical protein CARUB_v10010111mg [Capsella rubella] gi|482574266|gb|EOA38453.1| hypothetical protein CARUB_v10010111mg [Capsella rubella] Length = 248 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +3 Query: 3 FFLSLFVFLCGTSWFIFGLLGKDPFVAIPNGFGCGLGAVQLILYAIYRNNK 155 FFLSLFVFLCGTSWF++GL+G+DPFVAIPNGFGC LG +QLILY IY NK Sbjct: 163 FFLSLFVFLCGTSWFVYGLIGRDPFVAIPNGFGCALGTLQLILYFIYCGNK 213 >ref|XP_004290589.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Fragaria vesca subsp. vesca] Length = 243 Score = 94.7 bits (234), Expect = 1e-17 Identities = 45/76 (59%), Positives = 53/76 (69%) Frame = +3 Query: 3 FFLSLFVFLCGTSWFIFGLLGKDPFVAIPNGFGCGLGAVQLILYAIYRNNKXXXXXXXXX 182 FF+SLFVFLCGTSWF++GLLG DPFVA+PNGFGC LGA+QLILY YR+ K Sbjct: 164 FFMSLFVFLCGTSWFVYGLLGHDPFVAVPNGFGCALGALQLILYFFYRDIKKQQPSAEDS 223 Query: 183 XXKQGSKTLQPKQSDG 230 K Q KQ++G Sbjct: 224 VELGLEKPHQSKQANG 239 >gb|AAF87899.1|AC015447_9 Unknown protein [Arabidopsis thaliana] Length = 202 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +3 Query: 3 FFLSLFVFLCGTSWFIFGLLGKDPFVAIPNGFGCGLGAVQLILYAIYRNNK 155 FFLSLFVFLCGTSWF++GL+G+DPFVAIPNGFGC LG +QLILY IY NK Sbjct: 118 FFLSLFVFLCGTSWFVYGLIGRDPFVAIPNGFGCALGTLQLILYFIYCGNK 168 >ref|NP_564140.1| bidirectional sugar transporter SWEET1 [Arabidopsis thaliana] gi|75154590|sp|Q8L9J7.1|SWET1_ARATH RecName: Full=Bidirectional sugar transporter SWEET1; Short=AtSWEET1 gi|21594011|gb|AAM65929.1| unknown [Arabidopsis thaliana] gi|28393568|gb|AAO42204.1| unknown protein [Arabidopsis thaliana] gi|28973143|gb|AAO63896.1| unknown protein [Arabidopsis thaliana] gi|332191983|gb|AEE30104.1| bidirectional sugar transporter SWEET1 [Arabidopsis thaliana] Length = 247 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +3 Query: 3 FFLSLFVFLCGTSWFIFGLLGKDPFVAIPNGFGCGLGAVQLILYAIYRNNK 155 FFLSLFVFLCGTSWF++GL+G+DPFVAIPNGFGC LG +QLILY IY NK Sbjct: 163 FFLSLFVFLCGTSWFVYGLIGRDPFVAIPNGFGCALGTLQLILYFIYCGNK 213 >ref|XP_002893163.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata] gi|297339005|gb|EFH69422.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata] Length = 247 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +3 Query: 3 FFLSLFVFLCGTSWFIFGLLGKDPFVAIPNGFGCGLGAVQLILYAIYRNNK 155 FFLSLFVFLCGTSWF++GL+G+DPFVAIPNGFGC LG +QLILY IY NK Sbjct: 163 FFLSLFVFLCGTSWFVYGLIGRDPFVAIPNGFGCALGTLQLILYFIYCGNK 213 >ref|XP_004498378.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Cicer arietinum] Length = 242 Score = 94.0 bits (232), Expect = 2e-17 Identities = 45/78 (57%), Positives = 50/78 (64%) Frame = +3 Query: 3 FFLSLFVFLCGTSWFIFGLLGKDPFVAIPNGFGCGLGAVQLILYAIYRNNKXXXXXXXXX 182 FFLSLFVFLCGTSWFIFGLLG DPF+A+PNG G LG VQLILY IYR+NK Sbjct: 163 FFLSLFVFLCGTSWFIFGLLGHDPFIAVPNGVGSALGTVQLILYLIYRDNKENAKTTTQE 222 Query: 183 XXKQGSKTLQPKQSDGPQ 236 + QP + Q Sbjct: 223 DSMEMGTAKQPSSKNATQ 240 >ref|XP_006356306.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Solanum tuberosum] Length = 253 Score = 93.6 bits (231), Expect = 3e-17 Identities = 44/51 (86%), Positives = 44/51 (86%) Frame = +3 Query: 3 FFLSLFVFLCGTSWFIFGLLGKDPFVAIPNGFGCGLGAVQLILYAIYRNNK 155 FFLSLFVFLCG SWF FGLLGKDPFVAIPNGFG GLG VQLILYAIY K Sbjct: 166 FFLSLFVFLCGASWFAFGLLGKDPFVAIPNGFGFGLGTVQLILYAIYCEKK 216